Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1846268..1846999 | Replicon | chromosome |
Accession | NZ_LR134169 | ||
Organism | Actinobacillus lignieresii strain NCTC10568 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | - |
Locus tag | ELZ64_RS08835 | Protein ID | WP_115587609.1 |
Coordinates | 1846268..1846735 (-) | Length | 156 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | B0BRD3 |
Locus tag | ELZ64_RS08840 | Protein ID | WP_005619269.1 |
Coordinates | 1846739..1846999 (-) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ELZ64_RS08810 | 1841626..1841997 | - | 372 | WP_005598830.1 | CrcB family protein | - |
ELZ64_RS08815 | 1842000..1843064 | - | 1065 | WP_126375245.1 | MFS transporter | - |
ELZ64_RS08820 | 1843159..1844267 | + | 1109 | Protein_1718 | anhydro-N-acetylmuramic acid kinase | - |
ELZ64_RS08825 | 1844321..1845235 | + | 915 | WP_126375247.1 | N-acetylmuramic acid 6-phosphate etherase | - |
ELZ64_RS08830 | 1845302..1846183 | - | 882 | WP_115587608.1 | 50S ribosomal protein L11 methyltransferase | - |
ELZ64_RS08835 | 1846268..1846735 | - | 468 | WP_115587609.1 | GNAT family N-acetyltransferase | Toxin |
ELZ64_RS08840 | 1846739..1846999 | - | 261 | WP_005619269.1 | DUF1778 domain-containing protein | Antitoxin |
ELZ64_RS08845 | 1847119..1848579 | - | 1461 | WP_126375249.1 | metalloprotease TldD | - |
ELZ64_RS08850 | 1848709..1849968 | + | 1260 | WP_126375251.1 | tRNA lysidine(34) synthetase TilS | - |
ELZ64_RS08855 | 1849995..1850285 | - | 291 | WP_005598848.1 | DUF5389 family protein | - |
ELZ64_RS08860 | 1850287..1851180 | - | 894 | WP_115590816.1 | site-specific tyrosine recombinase XerD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 156 a.a. Molecular weight: 17197.17 Da Isoelectric Point: 8.9527
>T286953 WP_115587609.1 NZ_LR134169:c1846735-1846268 [Actinobacillus lignieresii]
MHAPELLSEQHIVRHFQCGEVVLDQWLQRTALKNQQNNASKTFVVCDENKQVMGFYCLSAGSVSHQFVAGALRRNMPDPI
PVIILGRLAVDCSAQGKQLGVSMLKDAVLKSKTVANQIGVKALLVHALNQQAKQFYLKYGFSCSPIDEMVLMLKL
MHAPELLSEQHIVRHFQCGEVVLDQWLQRTALKNQQNNASKTFVVCDENKQVMGFYCLSAGSVSHQFVAGALRRNMPDPI
PVIILGRLAVDCSAQGKQLGVSMLKDAVLKSKTVANQIGVKALLVHALNQQAKQFYLKYGFSCSPIDEMVLMLKL
Download Length: 468 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|