Detailed information of TA system TA286951

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): hicAB/HicA-HicB
• Location: 623622..624235
• Replicon: chromosome
• Accession: NZ_LR134169
• Organism: Actinobacillus lignieresii strain NCTC10568

Toxin (Protein)

• Gene name: hicA
• Uniprot ID: -
• Locus tag: ELZ64_RS02890
• Protein ID: WP_115590007.1
• Coordinates: 623622..623804 (+)
• Length: 61 a.a.

Antitoxin (Protein)

• Gene name: hicB
• Uniprot ID: -
• Locus tag: ELZ64_RS02895
• Protein ID: WP_126374585.1
• Coordinates: 623828..624235 (+)
• Length: 136 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
ELZ64_RS02860	620823..621278	-	456	WP_126374580.1	hypothetical protein	-
ELZ64_RS02865	621281..621610	-	330	WP_126374581.1	hypothetical protein	-
ELZ64_RS02870	621700..621945	-	246	WP_052190378.1	hypothetical protein	-
ELZ64_RS02875	622048..622260	-	213	WP_126374582.1	helix-turn-helix domain-containing protein	-
ELZ64_RS02880	622375..623064	+	690	WP_126374583.1	helix-turn-helix transcriptional regulator	-
ELZ64_RS02885	623093..623476	+	384	WP_126374584.1	hypothetical protein	-
ELZ64_RS02890	623622..623804	+	183	WP_115590007.1	type II toxin-antitoxin system HicA family toxin	Toxin
ELZ64_RS02895	623828..624235	+	408	WP_126374585.1	type II toxin-antitoxin system HicB family antitoxin	Antitoxin
ELZ64_RS02900	624247..624639	+	393	WP_126374586.1	hypothetical protein	-
ELZ64_RS02905	624636..625858	-	1223	Protein_561	phage late control D family protein	-
ELZ64_RS02910	625861..626298	-	438	WP_126374587.1	phage tail protein	-
ELZ64_RS11565	626305..626472	-	168	WP_164550500.1	hypothetical protein	-
ELZ64_RS02915	626541..626657	-	117	WP_197718033.1	GpE family phage tail protein	-
ELZ64_RS02920	626687..626983	-	297	WP_126374589.1	phage tail assembly protein	-
ELZ64_RS02925	627040..627546	-	507	WP_115590018.1	phage major tail tube protein	-
ELZ64_RS02930	627552..628745	-	1194	WP_126374590.1	phage tail sheath protein	-
ELZ64_RS02935	628850..629104	-	255	WP_126374591.1	DNA helicase UvrD	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Prophage	-	-	614718..649049	34331

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• HicA mRNA interferase family (4-59)

Antitoxin

• HicB-like antitoxin of toxin-antitoxin system (3-128)

Sequences

Toxin

Protein

• Length: 61 a.a.
• Molecular weight: 6771.88 Da
• Isoelectric Point: 10.9132

>T286951 WP_115590007.1 NZ_LR134169:623622-623804 [Actinobacillus lignieresii]
VTSAELIKLIESDGWYRVNIAGSHHQFKHPTKKGRVTIPHPKKDLNIKTQNSILKQAGLK

Nucleotide

• Length: 183 bp

Antitoxin

Protein

• Length: 136 a.a.
• Molecular weight: 15139.19 Da
• Isoelectric Point: 4.4693

>AT286951 WP_126374585.1 NZ_LR134169:623828-624235 [Actinobacillus lignieresii]
MLYPIAIELGDEKHAYGVVVPDVPGCFSAGDTIEEAFQNAKEAIPFHIEGMLEDGEEIPQPTSIDIHRNNPDYEGFMWSV
VDVDLTHLMGKSEKLNITLPSLLIKRIDEFVARHPDYKNRSNFLAKVATDRLLSA

Nucleotide

• Length: 408 bp