Detailed information of TA system TA286949

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): PumA-relB/COG3657-DUF971
• Location: 1373971..1374560
• Replicon: chromosome
• Accession: NZ_LR134168
• Organism: Haemophilus influenzae strain NCTC11394

Toxin (Protein)

• Gene name: PumA
• Uniprot ID: A0A852PKG5
• Locus tag: ELZ62_RS07045
• Protein ID: WP_005662099.1
• Coordinates: 1374261..1374560 (-)
• Length: 100 a.a.

Antitoxin (Protein)

• Gene name: relB
• Uniprot ID: -
• Locus tag: ELZ62_RS07040
• Protein ID: WP_015702300.1
• Coordinates: 1373971..1374264 (-)
• Length: 98 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
ELZ62_RS06980	1369011..1369250	+	240	WP_050792027.1	hypothetical protein	-
ELZ62_RS06985	1369277..1369573	+	297	WP_015702309.1	hypothetical protein	-
ELZ62_RS06990	1369632..1369793	-	162	Protein_1305	helix-turn-helix domain-containing protein	-
ELZ62_RS06995	1369790..1370095	-	306	Protein_1306	phage antirepressor KilAC domain-containing protein	-
ELZ62_RS07000	1370087..1370755	+	669	WP_041175131.1	phage regulatory protein/antirepressor Ant	-
ELZ62_RS07005	1370752..1371432	+	681	WP_015702305.1	helix-turn-helix domain-containing protein	-
ELZ62_RS07010	1371429..1372055	+	627	WP_015702304.1	replication P	-
ELZ62_RS07015	1372052..1372276	+	225	WP_015702303.1	hypothetical protein	-
ELZ62_RS07020	1372313..1372729	+	417	WP_005662137.1	recombination protein NinB	-
ELZ62_RS07025	1372809..1373012	+	204	WP_015701526.1	elongation factor Tu	-
ELZ62_RS07030	1373015..1373569	+	555	WP_015702302.1	recombination protein NinG	-
ELZ62_RS07035	1373571..1373939	+	369	WP_015702301.1	antitermination protein	-
ELZ62_RS07040	1373971..1374264	-	294	WP_015702300.1	putative addiction module antidote protein	Antitoxin
ELZ62_RS07045	1374261..1374560	-	300	WP_005662099.1	type II toxin-antitoxin system RelE/ParE family toxin	Toxin
ELZ62_RS07050	1374928..1375605	+	678	WP_015702298.1	hypothetical protein	-
ELZ62_RS09380	1375680..1375817	+	138	WP_015702297.1	hypothetical protein	-
ELZ62_RS07055	1375941..1376297	+	357	WP_005650535.1	phage holin, lambda family	-
ELZ62_RS07060	1376266..1376868	+	603	WP_015702296.1	glycoside hydrolase family 19 protein	-
ELZ62_RS07065	1376861..1377184	+	324	WP_041175082.1	DUF2570 family protein	-
ELZ62_RS07070	1377096..1377377	+	282	WP_041175081.1	hypothetical protein	-
ELZ62_RS07075	1377379..1377726	-	348	WP_015702293.1	helix-turn-helix domain-containing protein	-
ELZ62_RS07080	1377710..1377961	-	252	WP_015702292.1	type II toxin-antitoxin system RelE/ParE family toxin	-
ELZ62_RS07085	1378038..1378550	+	513	WP_011272619.1	terminase small subunit	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Prophage	-	-	1358116..1400438	42322
	-	inside	Prophage	-	-	1341426..1400438	59012

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Toxin HigB-like (14-86)

Antitoxin

• Cro/C1-type helix-turn-helix domain (46-89)

Sequences

Toxin

Protein

• Length: 100 a.a.
• Molecular weight: 11197.10 Da
• Isoelectric Point: 10.4328

>T286949 WP_005662099.1 NZ_LR134168:c1374560-1374261 [Haemophilus influenzae]
MTIQIKTTLTFDSWLSKLKNLRAKAKINARIKRLQFGNFGDIKSVNDGIFELRIDEGQGYRIYLKNQNGVLVILLCGGDK
STQEKDIKQAKLLAQELGL

Nucleotide

• Length: 300 bp

Antitoxin

Protein

• Length: 98 a.a.
• Molecular weight: 10917.44 Da
• Isoelectric Point: 4.4488

>AT286949 WP_015702300.1 NZ_LR134168:c1374264-1373971 [Haemophilus influenzae]
MTEQLKDFDVAEHLISEEEIQLYLNEILQEDNIELILSSLGDIARARNMSQIARDAGISREGLYKALSGTGNPTFATVMK
VMKALNLQFQVQQSRFA

Nucleotide

• Length: 294 bp

Structures

Toxin

• AlphaFold DB: A0A852PKG5