Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) VapXD/-
Location 580939..581416 Replicon chromosome
Accession NZ_LR134168
Organism Haemophilus influenzae strain NCTC11394

Toxin (Protein)


Gene name VapD Uniprot ID -
Locus tag ELZ62_RS09400 Protein ID WP_015701676.1
Coordinates 581279..581416 (+) Length 46 a.a.

Antitoxin (Protein)


Gene name VapX Uniprot ID A0A0M1GIA6
Locus tag ELZ62_RS02965 Protein ID WP_005649350.1
Coordinates 580939..581130 (+) Length 64 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ELZ62_RS02940 576518..577150 + 633 WP_041175109.1 dTMP kinase -
ELZ62_RS02945 577147..578130 + 984 WP_015701679.1 DNA polymerase III subunit delta' -
ELZ62_RS02950 578185..578967 + 783 WP_005649353.1 YchF/TatD family DNA exonuclease -
ELZ62_RS02955 578994..579518 + 525 WP_015701678.1 DUF1523 family protein -
ELZ62_RS02960 579569..580867 + 1299 WP_015701677.1 hemolysin family protein -
ELZ62_RS02965 580939..581130 + 192 WP_005649350.1 DUF5397 domain-containing protein Antitoxin
ELZ62_RS09400 581279..581416 + 138 WP_015701676.1 virulence-associated protein VapD Toxin
ELZ62_RS02975 581509..582039 + 531 WP_005686915.1 hypothetical protein -
ELZ62_RS02980 582111..583610 + 1500 WP_015701675.1 fused PTS fructose transporter subunit IIA/HPr protein -
ELZ62_RS02985 583612..584583 + 972 WP_015701674.1 1-phosphofructokinase -
ELZ62_RS02990 584555..586225 + 1671 WP_015701673.1 fructose-specific PTS transporter subunit EIIC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 576518..655939 79421


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Protein of unknown function DUF5397

(1-63)


Sequences

Toxin        


Download         Length: 46 a.a.        Molecular weight: 5422.16 Da        Isoelectric Point: 4.7105

>T286948 WP_015701676.1 NZ_LR134168:581279-581416 [Haemophilus influenzae]
MNEDMANLFQAMNALKQLAWISQSVRDIRAFRIEQWSDFTDFIRN

Download         Length: 138 bp

Antitoxin


Download         Length: 64 a.a.        Molecular weight: 7047.02 Da        Isoelectric Point: 3.9930

>AT286948 WP_005649350.1 NZ_LR134168:580939-581130 [Haemophilus influenzae]
MELRQQIPTGCIKQFGQFGVPYVVGEVAEFLPDGDVLVNITLLQSGEKDIYRLSHLLEDPEAE

Download         Length: 192 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A0M1GIA6

References