Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-RelB |
Location | 299978..300582 | Replicon | chromosome |
Accession | NZ_LR134168 | ||
Organism | Haemophilus influenzae strain NCTC11394 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A822VCP0 |
Locus tag | ELZ62_RS01515 | Protein ID | WP_015701819.1 |
Coordinates | 299978..300286 (-) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q4QMK8 |
Locus tag | ELZ62_RS01520 | Protein ID | WP_005692346.1 |
Coordinates | 300286..300582 (-) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ELZ62_RS01505 | 295164..296462 | - | 1299 | WP_015701821.1 | trigger factor | - |
ELZ62_RS01510 | 296817..299921 | + | 3105 | WP_126507554.1 | TonB-dependent hemoglobin/transferrin/lactoferrin family receptor | - |
ELZ62_RS01515 | 299978..300286 | - | 309 | WP_015701819.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | Toxin |
ELZ62_RS01520 | 300286..300582 | - | 297 | WP_005692346.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
ELZ62_RS01525 | 300702..301556 | - | 855 | WP_015701818.1 | DUF3298 domain-containing protein | - |
ELZ62_RS01530 | 301575..303434 | - | 1860 | WP_015701817.1 | selenocysteine-specific translation elongation factor | - |
ELZ62_RS01535 | 303431..304816 | - | 1386 | WP_015701816.1 | L-seryl-tRNA(Sec) selenium transferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11919.74 Da Isoelectric Point: 8.9408
>T286945 WP_015701819.1 NZ_LR134168:c300286-299978 [Haemophilus influenzae]
MSEEKPLKVSYSKQFVRDLTDLAKRSPNVLIGSKYITAIYCLLNRLPLPENYQDHALVGEWKGYRDCHIQGNLVLIYQYV
IQDKFDELKFSRLNTHSQTALK
MSEEKPLKVSYSKQFVRDLTDLAKRSPNVLIGSKYITAIYCLLNRLPLPENYQDHALVGEWKGYRDCHIQGNLVLIYQYV
IQDKFDELKFSRLNTHSQTALK
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A822VCP0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q4QMK8 |