Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-DnaT |
Location | 76798..77332 | Replicon | chromosome |
Accession | NZ_LR134168 | ||
Organism | Haemophilus influenzae strain NCTC11394 |
Toxin (Protein)
Gene name | relE | Uniprot ID | Q849T7 |
Locus tag | ELZ62_RS00395 | Protein ID | WP_015701940.1 |
Coordinates | 77042..77332 (+) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A2X4XNI1 |
Locus tag | ELZ62_RS00390 | Protein ID | WP_015701941.1 |
Coordinates | 76798..77052 (+) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ELZ62_RS00355 | 72383..72643 | + | 261 | WP_005651528.1 | hypothetical protein | - |
ELZ62_RS00360 | 72673..73038 | + | 366 | WP_015701945.1 | endonuclease domain-containing protein | - |
ELZ62_RS00365 | 73375..75441 | + | 2067 | WP_015701944.1 | glycine--tRNA ligase subunit beta | - |
ELZ62_RS00375 | 75960..76268 | + | 309 | Protein_71 | P2 family phage major capsid protein | - |
ELZ62_RS00380 | 76268..76492 | + | 225 | WP_015701942.1 | hypothetical protein | - |
ELZ62_RS00385 | 76501..76707 | + | 207 | WP_041175054.1 | hypothetical protein | - |
ELZ62_RS00390 | 76798..77052 | + | 255 | WP_015701941.1 | stability protein StbD | Antitoxin |
ELZ62_RS00395 | 77042..77332 | + | 291 | WP_015701940.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
ELZ62_RS09360 | 77789..77926 | + | 138 | WP_005663612.1 | hypothetical protein | - |
ELZ62_RS00405 | 78394..79428 | - | 1035 | WP_015701939.1 | DNA polymerase III subunit delta | - |
ELZ62_RS00410 | 79428..79931 | - | 504 | WP_015701938.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11496.44 Da Isoelectric Point: 10.6484
>T286944 WP_015701940.1 NZ_LR134168:77042-77332 [Haemophilus influenzae]
MTYKLIFDKRALKEWNKLGETLRQQFKNKLAERMINPRIQADKLKGENDLYKIKLRSAGYRLVYQVRDQEITIIVVSIGK
RERLEVYKTAEQRTAH
MTYKLIFDKRALKEWNKLGETLRQQFKNKLAERMINPRIQADKLKGENDLYKIKLRSAGYRLVYQVRDQEITIIVVSIGK
RERLEVYKTAEQRTAH
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q849T7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2X4XNI1 |