Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 1996427..1996988 | Replicon | chromosome |
Accession | NZ_LR134167 | ||
Organism | Avibacterium volantium strain NCTC3438 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | ELZ61_RS09430 | Protein ID | WP_126373185.1 |
Coordinates | 1996659..1996988 (+) | Length | 110 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | ELZ61_RS09425 | Protein ID | WP_126373183.1 |
Coordinates | 1996427..1996669 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ELZ61_RS09405 | 1991685..1992527 | + | 843 | WP_035686885.1 | ABC transporter permease | - |
ELZ61_RS09410 | 1992551..1993633 | + | 1083 | WP_126373671.1 | extracellular solute-binding protein | - |
ELZ61_RS09415 | 1993819..1995129 | + | 1311 | WP_126373179.1 | histidine-type phosphatase | - |
ELZ61_RS09420 | 1995222..1996307 | + | 1086 | WP_126373181.1 | ROK family protein | - |
ELZ61_RS09425 | 1996427..1996669 | + | 243 | WP_126373183.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
ELZ61_RS09430 | 1996659..1996988 | + | 330 | WP_126373185.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
ELZ61_RS09435 | 1996992..1997558 | - | 567 | WP_103853318.1 | elongation factor P | - |
ELZ61_RS09440 | 1997593..1998606 | + | 1014 | WP_126373187.1 | EF-P beta-lysylation protein EpmB | - |
ELZ61_RS09445 | 1998700..1999920 | + | 1221 | WP_126373189.1 | opacity-associated protein OapA | - |
ELZ61_RS09450 | 2000009..2000914 | - | 906 | WP_126373191.1 | recombination-associated protein RdgC | - |
ELZ61_RS09455 | 2000985..2001800 | + | 816 | WP_126373193.1 | pyrroline-5-carboxylate reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 13027.23 Da Isoelectric Point: 10.2293
>T286941 WP_126373185.1 NZ_LR134167:1996659-1996988 [Avibacterium volantium]
MNYELVFDPRALKEWRKLDENIKAQFKKKLAEILRNPHIEANRLSHFPDCYKIKLRNAGYRLIYQVQDEQVIVFVVAIGK
QENNQAYKEAKKSYKKSVLLYGFFVFALR
MNYELVFDPRALKEWRKLDENIKAQFKKKLAEILRNPHIEANRLSHFPDCYKIKLRNAGYRLIYQVQDEQVIVFVVAIGK
QENNQAYKEAKKSYKKSVLLYGFFVFALR
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|