Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
| Location | 562057..562687 | Replicon | chromosome |
| Accession | NZ_LR134167 | ||
| Organism | Avibacterium volantium strain NCTC3438 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | ELZ61_RS02750 | Protein ID | WP_126371256.1 |
| Coordinates | 562361..562687 (-) | Length | 109 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | ELZ61_RS02745 | Protein ID | WP_126371254.1 |
| Coordinates | 562057..562380 (-) | Length | 108 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ELZ61_RS02720 | 557665..558126 | - | 462 | WP_115248572.1 | DMT family transporter | - |
| ELZ61_RS02725 | 558230..558898 | - | 669 | WP_126371248.1 | NAD(P)H-dependent oxidoreductase | - |
| ELZ61_RS02730 | 559040..560353 | - | 1314 | WP_126371250.1 | anaerobic C4-dicarboxylate transporter | - |
| ELZ61_RS02735 | 560631..561077 | + | 447 | WP_126371252.1 | rhodanese-like domain-containing protein | - |
| ELZ61_RS02740 | 561096..561602 | + | 507 | WP_103855395.1 | protein-export chaperone SecB | - |
| ELZ61_RS02745 | 562057..562380 | - | 324 | WP_126371254.1 | putative addiction module antidote protein | Antitoxin |
| ELZ61_RS02750 | 562361..562687 | - | 327 | WP_126371256.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| ELZ61_RS02755 | 562892..563905 | + | 1014 | WP_126371258.1 | NAD(P)H-dependent glycerol-3-phosphate dehydrogenase | - |
| ELZ61_RS02760 | 563907..564704 | + | 798 | WP_126371260.1 | serine O-acetyltransferase | - |
| ELZ61_RS02765 | 564714..565529 | + | 816 | WP_126371262.1 | shikimate 5-dehydrogenase | - |
| ELZ61_RS02770 | 565597..567456 | - | 1860 | WP_126371265.1 | selenocysteine-specific translation elongation factor | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 109 a.a. Molecular weight: 12275.23 Da Isoelectric Point: 10.2562
>T286937 WP_126371256.1 NZ_LR134167:c562687-562361 [Avibacterium volantium]
MNEIILTDEFRLWLTKLKNPIAKATIARRIKNAIKGNFGDHKPLAGANGIYEMRIATGAGYRVYYVQQGKVVYVLLCGGD
KSTQKNDIERAKQLFNVLQRGENEINKY
MNEIILTDEFRLWLTKLKNPIAKATIARRIKNAIKGNFGDHKPLAGANGIYEMRIATGAGYRVYYVQQGKVVYVLLCGGD
KSTQKNDIERAKQLFNVLQRGENEINKY
Download Length: 327 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|