Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 581281..581917 | Replicon | chromosome |
Accession | NZ_LR134165 | ||
Organism | Bacillus paralicheniformis strain NCTC8721 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | M5P3Q9 |
Locus tag | EL050_RS02910 | Protein ID | WP_003179128.1 |
Coordinates | 581567..581917 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | M5PDU2 |
Locus tag | EL050_RS02905 | Protein ID | WP_006638778.1 |
Coordinates | 581281..581562 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL050_RS02885 | 576392..577876 | + | 1485 | WP_023857868.1 | PH domain-containing protein | - |
EL050_RS02890 | 577873..578472 | - | 600 | WP_023857867.1 | rhomboid family intramembrane serine protease | - |
EL050_RS02895 | 578816..579775 | + | 960 | WP_164468292.1 | outer membrane lipoprotein carrier protein LolA | - |
EL050_RS02900 | 580000..581169 | + | 1170 | WP_023857864.1 | alanine racemase | - |
EL050_RS02905 | 581281..581562 | + | 282 | WP_006638778.1 | hypothetical protein | Antitoxin |
EL050_RS02910 | 581567..581917 | + | 351 | WP_003179128.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
EL050_RS02915 | 582035..582862 | + | 828 | WP_025810067.1 | RsbT co-antagonist protein RsbRA | - |
EL050_RS02920 | 582866..583231 | + | 366 | WP_020450259.1 | STAS domain-containing protein | - |
EL050_RS02925 | 583234..583635 | + | 402 | WP_020450260.1 | anti-sigma regulatory factor | - |
EL050_RS02930 | 583646..584653 | + | 1008 | WP_020450261.1 | PP2C family protein-serine/threonine phosphatase | - |
EL050_RS02935 | 584712..585038 | + | 327 | WP_020450262.1 | anti-sigma factor antagonist | - |
EL050_RS02940 | 585038..585520 | + | 483 | WP_020450263.1 | anti-sigma B factor RsbW | - |
EL050_RS02945 | 585486..586277 | + | 792 | WP_023857858.1 | RNA polymerase sigma factor SigB | - |
EL050_RS02950 | 586274..586873 | + | 600 | WP_020450265.1 | SpoIIE family protein phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12990.03 Da Isoelectric Point: 5.7234
>T286935 WP_003179128.1 NZ_LR134165:581567-581917 [Bacillus paralicheniformis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNNIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVNEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNNIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVNEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6I7FHI4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | M5PDU2 |