Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
| Location | 3401861..3402519 | Replicon | chromosome |
| Accession | NZ_LR134164 | ||
| Organism | Enterobacter hormaechei strain NCTC11571 | ||
Toxin (Protein)
| Gene name | ypjF | Uniprot ID | - |
| Locus tag | EL051_RS16265 | Protein ID | WP_032637385.1 |
| Coordinates | 3402199..3402519 (+) | Length | 107 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | - |
| Locus tag | EL051_RS16260 | Protein ID | WP_126315089.1 |
| Coordinates | 3401861..3402178 (+) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL051_RS16220 | 3397421..3398254 | + | 834 | WP_126315082.1 | DUF945 domain-containing protein | - |
| EL051_RS16225 | 3398456..3399160 | + | 705 | WP_126315083.1 | WYL domain-containing protein | - |
| EL051_RS16230 | 3399157..3399771 | + | 615 | WP_046495819.1 | hypothetical protein | - |
| EL051_RS16235 | 3399860..3400270 | + | 411 | WP_126315084.1 | hypothetical protein | - |
| EL051_RS16240 | 3400348..3400584 | + | 237 | WP_126315085.1 | DUF905 domain-containing protein | - |
| EL051_RS16245 | 3400663..3401121 | + | 459 | WP_126315086.1 | antirestriction protein | - |
| EL051_RS16250 | 3401130..3401612 | + | 483 | WP_126315087.1 | DNA repair protein RadC | - |
| EL051_RS16255 | 3401621..3401842 | + | 222 | WP_126315088.1 | DUF987 domain-containing protein | - |
| EL051_RS16260 | 3401861..3402178 | + | 318 | WP_126315089.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| EL051_RS16265 | 3402199..3402519 | + | 321 | WP_032637385.1 | TA system toxin CbtA family protein | Toxin |
| EL051_RS16270 | 3403102..3404340 | + | 1239 | WP_126315090.1 | ribokinase | - |
| EL051_RS16275 | 3404408..3405385 | + | 978 | WP_126315091.1 | sugar ABC transporter permease | - |
| EL051_RS16280 | 3405385..3406284 | + | 900 | WP_126315092.1 | carbohydrate ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3381344..3402519 | 21175 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12146.14 Da Isoelectric Point: 7.1656
>T286932 WP_032637385.1 NZ_LR134164:3402199-3402519 [Enterobacter hormaechei]
MKTLPATTLWAAKPCPSPVIVWQMLLSRLLDQHYGLTLNDTPFSDETVIKEHIDAGISLADAVNFLVEKYELVRIDRKGF
SWQEQSPFITAVDILKARRAMREMRT
MKTLPATTLWAAKPCPSPVIVWQMLLSRLLDQHYGLTLNDTPFSDETVIKEHIDAGISLADAVNFLVEKYELVRIDRKGF
SWQEQSPFITAVDILKARRAMREMRT
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|