Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 2251431..2252170 | Replicon | chromosome |
| Accession | NZ_LR134164 | ||
| Organism | Enterobacter hormaechei strain NCTC11571 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | - |
| Locus tag | EL051_RS10885 | Protein ID | WP_063137753.1 |
| Coordinates | 2251431..2251916 (-) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | A0A837FCR9 |
| Locus tag | EL051_RS10890 | Protein ID | WP_003857131.1 |
| Coordinates | 2251904..2252170 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL051_RS10860 | 2247215..2248114 | - | 900 | WP_023300124.1 | LysR family transcriptional regulator | - |
| EL051_RS10865 | 2248453..2249475 | + | 1023 | WP_126314876.1 | alpha/beta hydrolase | - |
| EL051_RS10870 | 2249571..2250335 | + | 765 | WP_023300126.1 | SDR family oxidoreductase | - |
| EL051_RS10875 | 2250870..2251100 | + | 231 | Protein_2086 | DUF4225 domain-containing protein | - |
| EL051_RS10880 | 2251075..2251413 | - | 339 | WP_126314877.1 | hypothetical protein | - |
| EL051_RS10885 | 2251431..2251916 | - | 486 | WP_063137753.1 | GNAT family N-acetyltransferase | Toxin |
| EL051_RS10890 | 2251904..2252170 | - | 267 | WP_003857131.1 | DUF1778 domain-containing protein | Antitoxin |
| EL051_RS10895 | 2252234..2253163 | - | 930 | WP_126314878.1 | LysR family transcriptional regulator | - |
| EL051_RS10900 | 2253293..2254681 | + | 1389 | WP_126314879.1 | MFS transporter | - |
| EL051_RS10905 | 2254660..2255217 | - | 558 | WP_045622668.1 | OmpH family outer membrane protein | - |
| EL051_RS10910 | 2255338..2256474 | - | 1137 | WP_126314880.1 | type 1 fimbrial protein | - |
| EL051_RS10915 | 2256498..2257022 | - | 525 | WP_126315298.1 | fimbrial protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2229743..2252170 | 22427 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17518.18 Da Isoelectric Point: 9.6275
>T286927 WP_063137753.1 NZ_LR134164:c2251916-2251431 [Enterobacter hormaechei]
VGRVTAPEPLSSVHQLAEFVSGEAVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDVSIRGNGLGADLLQDAVLRCYRVAENIGVRAIMVHALTEDAKAFYIHHGFKASQTQERTLFLRLP
Q
VGRVTAPEPLSSVHQLAEFVSGEAVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDVSIRGNGLGADLLQDAVLRCYRVAENIGVRAIMVHALTEDAKAFYIHHGFKASQTQERTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|