Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1099516..1100137 | Replicon | chromosome |
Accession | NZ_LR134164 | ||
Organism | Enterobacter hormaechei strain NCTC11571 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | A0A837FFM2 |
Locus tag | EL051_RS05275 | Protein ID | WP_015571250.1 |
Coordinates | 1099516..1099734 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | F5RUW7 |
Locus tag | EL051_RS05280 | Protein ID | WP_006809850.1 |
Coordinates | 1099763..1100137 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL051_RS05245 | 1095528..1095788 | + | 261 | WP_015571255.1 | type B 50S ribosomal protein L31 | - |
EL051_RS05250 | 1095791..1095931 | + | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
EL051_RS05255 | 1095928..1096638 | - | 711 | WP_105322505.1 | GNAT family N-acetyltransferase | - |
EL051_RS05260 | 1096741..1098201 | + | 1461 | WP_023299463.1 | PLP-dependent aminotransferase family protein | - |
EL051_RS05265 | 1098173..1098640 | - | 468 | WP_126314657.1 | hypothetical protein | - |
EL051_RS05270 | 1098757..1099308 | - | 552 | WP_023305596.1 | maltose O-acetyltransferase | - |
EL051_RS05275 | 1099516..1099734 | - | 219 | WP_015571250.1 | hemolysin expression modulator Hha | Toxin |
EL051_RS05280 | 1099763..1100137 | - | 375 | WP_006809850.1 | Hha toxicity modulator TomB | Antitoxin |
EL051_RS05285 | 1100647..1103793 | - | 3147 | WP_023299464.1 | multidrug efflux RND transporter permease subunit | - |
EL051_RS05290 | 1103816..1105009 | - | 1194 | WP_022647272.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8583.95 Da Isoelectric Point: 8.9008
>T286926 WP_015571250.1 NZ_LR134164:c1099734-1099516 [Enterobacter hormaechei]
MSDKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR
MSDKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14497.28 Da Isoelectric Point: 4.8989
>AT286926 WP_006809850.1 NZ_LR134164:c1100137-1099763 [Enterobacter hormaechei]
MDEYSPKRHDIAQLKFLCESLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFTNVSRANPVSLSC
MDEYSPKRHDIAQLKFLCESLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFTNVSRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A837FFM2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A837FGN8 |