Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3598269..3598889 | Replicon | chromosome |
Accession | NZ_LR134163 | ||
Organism | Yersinia pseudotuberculosis strain NCTC10217 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | Q66DR5 |
Locus tag | EL027_RS16495 | Protein ID | WP_002208622.1 |
Coordinates | 3598269..3598472 (-) | Length | 68 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | Q66DR4 |
Locus tag | EL027_RS16500 | Protein ID | WP_002218472.1 |
Coordinates | 3598521..3598889 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL027_RS16465 | 3593271..3593609 | + | 339 | WP_002208627.1 | P-II family nitrogen regulator | - |
EL027_RS16470 | 3593649..3594938 | + | 1290 | WP_002228344.1 | ammonium transporter AmtB | - |
EL027_RS16475 | 3595200..3596060 | - | 861 | WP_002208625.1 | acyl-CoA thioesterase II | - |
EL027_RS16480 | 3596317..3596838 | + | 522 | WP_011191872.1 | YbaY family lipoprotein | - |
EL027_RS16485 | 3596974..3597363 | - | 390 | WP_002208623.1 | MGMT family protein | - |
EL027_RS21710 | 3597377..3597529 | - | 153 | WP_071819137.1 | 6-O-methylguanine DNA methyltransferase | - |
EL027_RS16495 | 3598269..3598472 | - | 204 | WP_002208622.1 | expression modulating protein YmoA | Toxin |
EL027_RS16500 | 3598521..3598889 | - | 369 | WP_002218472.1 | Hha toxicity modulator TomB | Antitoxin |
EL027_RS16505 | 3599048..3599401 | - | 354 | WP_002208619.1 | hypothetical protein | - |
EL027_RS16510 | 3600266..3600409 | - | 144 | WP_002208618.1 | type B 50S ribosomal protein L36 | - |
EL027_RS16515 | 3600425..3600685 | - | 261 | WP_002208617.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8063.31 Da Isoelectric Point: 6.4573
>T286920 WP_002208622.1 NZ_LR134163:c3598472-3598269 [Yersinia pseudotuberculosis]
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPPTVWQHVK
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPPTVWQHVK
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14215.00 Da Isoelectric Point: 4.6121
>AT286920 WP_002218472.1 NZ_LR134163:c3598889-3598521 [Yersinia pseudotuberculosis]
MDEYSPKRHDIAQLKFLCESLYDEGIATLGDSHHGWINDPTSAINLQLNDLIEHIASFVMSFKIKYPDGSQLSELVEEYL
DDTYTLFSSYGINDPELRRWQKTKEHLFRLFSGEYVCTLMKT
MDEYSPKRHDIAQLKFLCESLYDEGIATLGDSHHGWINDPTSAINLQLNDLIEHIASFVMSFKIKYPDGSQLSELVEEYL
DDTYTLFSSYGINDPELRRWQKTKEHLFRLFSGEYVCTLMKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|