286919

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yfjZ-ypjF/CbtA-CbeA
Location 2442025..2442781 Replicon chromosome
Accession NZ_LR134163
Organism Yersinia pseudotuberculosis strain NCTC10217

Toxin (Protein)


Gene name ypjF Uniprot ID A0A3G5KDU1
Locus tag EL027_RS11125 Protein ID WP_032467110.1
Coordinates 2442413..2442781 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name yfjZ Uniprot ID Q664A5
Locus tag EL027_RS11120 Protein ID WP_011193303.1
Coordinates 2442025..2442360 (+) Length 112 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL027_RS11085 2437188..2437970 + 783 WP_001317493.1 IS21-like element IS100kyp family helper ATPase IstB -
EL027_RS11090 2438036..2438272 - 237 Protein_2058 inovirus Gp2 family protein -
EL027_RS11095 2438937..2439230 + 294 Protein_2059 ATP-binding protein -
EL027_RS11100 2439278..2439901 + 624 WP_126286855.1 hypothetical protein -
EL027_RS11105 2440149..2440703 + 555 WP_011193306.1 hypothetical protein -
EL027_RS11110 2440731..2441351 + 621 WP_011193305.1 hypothetical protein -
EL027_RS11115 2441534..2442013 + 480 WP_011193304.1 hypothetical protein -
EL027_RS11120 2442025..2442360 + 336 WP_011193303.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
EL027_RS11125 2442413..2442781 + 369 WP_032467110.1 TA system toxin CbtA family protein Toxin
EL027_RS11130 2443008..2443862 + 855 WP_032467109.1 DUF4942 domain-containing protein -
EL027_RS11135 2444261..2444533 + 273 WP_011193300.1 Arm DNA-binding domain-containing protein -
EL027_RS11140 2444768..2445175 + 408 WP_011193299.1 hypothetical protein -
EL027_RS11145 2445198..2445524 + 327 WP_011193298.1 hypothetical protein -
EL027_RS11150 2445466..2445966 + 501 WP_002214364.1 virulence RhuM family protein -
EL027_RS11155 2445963..2446721 - 759 WP_011193297.1 ABC transporter ATP-binding protein -
EL027_RS11160 2446718..2447725 - 1008 WP_011193296.1 iron chelate uptake ABC transporter family permease subunit -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 2438021..2453282 15261


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-111)

Antitoxin

Antitoxin CbeA

(7-106)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13723.81 Da        Isoelectric Point: 6.4530

>T286919 WP_032467110.1 NZ_LR134163:2442413-2442781 [Yersinia pseudotuberculosis]
MQILPVTPKRAAYACPSPVVVWQSMLTYLLEQHYGLALNDTEFSDDAVIHEYIDAGISLSDALNFTVEKFGLVRIDRRGF
SCQEQSPFITAIDILRARRATGLMTRLGYQTIISVIRGEKQT

Download         Length: 369 bp

Antitoxin


Download         Length: 112 a.a.        Molecular weight: 12452.06 Da        Isoelectric Point: 6.0555

>AT286919 WP_011193303.1 NZ_LR134163:2442025-2442360 [Yersinia pseudotuberculosis]
MPSITTPAWGLKRNVTPQFGARLVQEGDRLHFLADRADINGTFSEVQVRDLDNAFPQFINYLELMLLSGELNPRHQHCVT
LYRNGLTCEADSLGSHGYVYLAIYPTPQSTA

Download         Length: 336 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3G5KDU1

Antitoxin

Source ID Structure
AlphaFold DB Q664A5

References