Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 1365773..1366445 | Replicon | chromosome |
| Accession | NZ_LR134163 | ||
| Organism | Yersinia pseudotuberculosis strain NCTC10217 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A0U1R236 |
| Locus tag | EL027_RS06290 | Protein ID | WP_012104676.1 |
| Coordinates | 1365773..1366198 (-) | Length | 142 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | Q666S3 |
| Locus tag | EL027_RS06295 | Protein ID | WP_002209939.1 |
| Coordinates | 1366179..1366445 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL027_RS06270 | 1361451..1361969 | + | 519 | WP_002209934.1 | flavodoxin FldB | - |
| EL027_RS06275 | 1362054..1363511 | - | 1458 | WP_032466588.1 | cell envelope integrity protein CreD | - |
| EL027_RS06280 | 1363632..1365050 | - | 1419 | WP_002209936.1 | two-component system sensor histidine kinase CreC | - |
| EL027_RS06285 | 1365075..1365773 | - | 699 | WP_002209937.1 | two-component system response regulator CreB | - |
| EL027_RS06290 | 1365773..1366198 | - | 426 | WP_012104676.1 | protein YgfX | Toxin |
| EL027_RS06295 | 1366179..1366445 | - | 267 | WP_002209939.1 | FAD assembly factor SdhE | Antitoxin |
| EL027_RS06300 | 1366762..1367754 | + | 993 | WP_012413924.1 | tRNA-modifying protein YgfZ | - |
| EL027_RS06305 | 1367827..1368324 | - | 498 | WP_002209941.1 | DUF2165 family protein | - |
| EL027_RS06310 | 1368582..1369283 | - | 702 | WP_012413925.1 | hemolysin III family protein | - |
| EL027_RS06315 | 1369485..1370588 | - | 1104 | WP_012413926.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 16467.40 Da Isoelectric Point: 10.1176
>T286918 WP_012104676.1 NZ_LR134163:c1366198-1365773 [Yersinia pseudotuberculosis]
VAQWRCNLRVSWHTQLFSLLAHGILVILTLVAPWPLGYTALWLVLLTLVVFECIRSQKRIKSCQGEIRLKPGNLVLWKRH
EWTVVKPPWITRYGVLLHLQQTGGHATRKRLWLSADSMSEDEWRQLCLLLRHSFESDDGTM
VAQWRCNLRVSWHTQLFSLLAHGILVILTLVAPWPLGYTALWLVLLTLVVFECIRSQKRIKSCQGEIRLKPGNLVLWKRH
EWTVVKPPWITRYGVLLHLQQTGGHATRKRLWLSADSMSEDEWRQLCLLLRHSFESDDGTM
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0U1R236 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E8XP12 |