Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3597843..3598461 | Replicon | chromosome |
| Accession | NZ_LR134161 | ||
| Organism | Yersinia enterocolitica subsp. enterocolitica strain NCTC13629 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | Q66DR5 |
| Locus tag | EL026_RS16860 | Protein ID | WP_002208622.1 |
| Coordinates | 3598258..3598461 (+) | Length | 68 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | A0A7U7FKE5 |
| Locus tag | EL026_RS16855 | Protein ID | WP_005163463.1 |
| Coordinates | 3597843..3598211 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL026_RS16820 | 3593497..3593757 | + | 261 | WP_005163438.1 | type B 50S ribosomal protein L31 | - |
| EL026_RS16825 | 3593773..3593916 | + | 144 | WP_002208618.1 | type B 50S ribosomal protein L36 | - |
| EL026_RS16830 | 3594044..3594922 | - | 879 | WP_005163442.1 | metal ABC transporter substrate-binding protein | - |
| EL026_RS16835 | 3594985..3595842 | - | 858 | WP_005163445.1 | metal ABC transporter permease | - |
| EL026_RS16840 | 3595856..3596566 | - | 711 | WP_014609124.1 | ABC transporter ATP-binding protein | - |
| EL026_RS16850 | 3597332..3597685 | + | 354 | WP_005163460.1 | hypothetical protein | - |
| EL026_RS16855 | 3597843..3598211 | + | 369 | WP_005163463.1 | Hha toxicity modulator TomB | Antitoxin |
| EL026_RS16860 | 3598258..3598461 | + | 204 | WP_002208622.1 | expression modulating protein YmoA | Toxin |
| EL026_RS16870 | 3599298..3599603 | + | 306 | WP_005163466.1 | MGMT family protein | - |
| EL026_RS16875 | 3599655..3600185 | - | 531 | WP_005163468.1 | YbaY family lipoprotein | - |
| EL026_RS16880 | 3600446..3601309 | + | 864 | WP_005163474.1 | acyl-CoA thioesterase II | - |
| EL026_RS16885 | 3601423..3602712 | - | 1290 | WP_005167660.1 | ammonium transporter AmtB | - |
| EL026_RS16890 | 3602752..3603090 | - | 339 | WP_002208627.1 | P-II family nitrogen regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8063.31 Da Isoelectric Point: 6.4573
>T286914 WP_002208622.1 NZ_LR134161:3598258-3598461 [Yersinia enterocolitica subsp. enterocolitica]
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPPTVWQHVK
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPPTVWQHVK
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14192.90 Da Isoelectric Point: 4.3377
>AT286914 WP_005163463.1 NZ_LR134161:3597843-3598211 [Yersinia enterocolitica subsp. enterocolitica]
MDEYSPKRHDVAQLKFLCESLYDEGIATLGDSHHGWVNDPTSAVNLQLNDLIEHIASFVMSFKIKYPDDGDLSELVEEYL
DDTYTLFSSYGINDPELQRWQKTKERLFRLFSGEYICTLMKT
MDEYSPKRHDVAQLKFLCESLYDEGIATLGDSHHGWVNDPTSAVNLQLNDLIEHIASFVMSFKIKYPDDGDLSELVEEYL
DDTYTLFSSYGINDPELQRWQKTKERLFRLFSGEYICTLMKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2K5S |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MN2 | |
| AlphaFold DB | A0A7U7FKE5 |