Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 1206264..1206936 | Replicon | chromosome |
| Accession | NZ_LR134161 | ||
| Organism | Yersinia enterocolitica subsp. enterocolitica strain NCTC13629 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A7U7FIQ4 |
| Locus tag | EL026_RS05485 | Protein ID | WP_005166047.1 |
| Coordinates | 1206511..1206936 (+) | Length | 142 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A7U7FJE4 |
| Locus tag | EL026_RS05480 | Protein ID | WP_004390965.1 |
| Coordinates | 1206264..1206530 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL026_RS05460 | 1201879..1202481 | - | 603 | WP_005164134.1 | HD domain-containing protein | - |
| EL026_RS05465 | 1202712..1203395 | + | 684 | WP_005180855.1 | hemolysin III family protein | - |
| EL026_RS05470 | 1203807..1204809 | - | 1003 | Protein_1017 | IS110 family transposase | - |
| EL026_RS05475 | 1205005..1205997 | - | 993 | WP_005166051.1 | tRNA-modifying protein YgfZ | - |
| EL026_RS05480 | 1206264..1206530 | + | 267 | WP_004390965.1 | FAD assembly factor SdhE | Antitoxin |
| EL026_RS05485 | 1206511..1206936 | + | 426 | WP_005166047.1 | protein YgfX | Toxin |
| EL026_RS05490 | 1206936..1207634 | + | 699 | WP_005166045.1 | two-component system response regulator CreB | - |
| EL026_RS05495 | 1207645..1209067 | + | 1423 | Protein_1022 | two-component system sensor histidine kinase CreC | - |
| EL026_RS05500 | 1209159..1210580 | + | 1422 | WP_005166043.1 | cell envelope integrity protein CreD | - |
| EL026_RS05505 | 1210639..1211157 | - | 519 | WP_005166042.1 | flavodoxin FldB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 16425.21 Da Isoelectric Point: 9.8217
>T286907 WP_005166047.1 NZ_LR134161:1206511-1206936 [Yersinia enterocolitica subsp. enterocolitica]
VAQWRCDLRISWHTQLFSLLAHGVLVTLTLVAPWPQGYTALWLVLLTLVVFECIRSQKNITSCQGEIRLKPGNIVLWKRH
EWVVIKQPWITRYGVLLSLQQTSSRSTRKRLWLAADSMSEEEWRQLCLLLRHSFGSDEGIN
VAQWRCDLRISWHTQLFSLLAHGVLVTLTLVAPWPQGYTALWLVLLTLVVFECIRSQKNITSCQGEIRLKPGNIVLWKRH
EWVVIKQPWITRYGVLLSLQQTSSRSTRKRLWLAADSMSEEEWRQLCLLLRHSFGSDEGIN
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U7FIQ4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U7FJE4 |