Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ypjF-yeeU/CbtA-CbeA |
| Location | 413956..414540 | Replicon | chromosome |
| Accession | NZ_LR134161 | ||
| Organism | Yersinia enterocolitica subsp. enterocolitica strain NCTC13629 | ||
Toxin (Protein)
| Gene name | ypjF | Uniprot ID | A0A7U7ISC5 |
| Locus tag | EL026_RS01840 | Protein ID | WP_005165296.1 |
| Coordinates | 413956..414324 (-) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | EL026_RS01845 | Protein ID | WP_129019424.1 |
| Coordinates | 414388..414540 (-) | Length | 51 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL026_RS01820 | 409163..410083 | + | 921 | WP_005165286.1 | ROK family protein | - |
| EL026_RS01825 | 410168..411130 | + | 963 | WP_005165289.1 | LacI family transcriptional regulator | - |
| EL026_RS01830 | 411164..411637 | - | 474 | WP_005165291.1 | GNAT family N-acetyltransferase | - |
| EL026_RS01835 | 412873..413727 | - | 855 | WP_005165294.1 | DUF4942 domain-containing protein | - |
| EL026_RS01840 | 413956..414324 | - | 369 | WP_005165296.1 | TA system toxin CbtA family protein | Toxin |
| EL026_RS01845 | 414388..414540 | - | 153 | WP_129019424.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| EL026_RS01850 | 414609..415811 | + | 1203 | WP_005178352.1 | IS256 family transposase | - |
| EL026_RS01855 | 415986..417449 | + | 1464 | WP_005166182.1 | alpha/beta hydrolase | - |
| EL026_RS01860 | 417682..419088 | - | 1407 | WP_005166180.1 | filamentous hemagglutinin N-terminal domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 414609..415811 | 1202 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13609.55 Da Isoelectric Point: 6.4731
>T286903 WP_005165296.1 NZ_LR134161:c414324-413956 [Yersinia enterocolitica subsp. enterocolitica]
MQTLPVTSKRAAYACLSPVIVWQSMLTYLLEQHYGLVLSDTEFSDDAVIHEHIDAGISLADALNFTVEKFDLARTDHRGF
SCQEQSPFITSIDILRARRATGLMTRMGYQTITSVIRGGKQA
MQTLPVTSKRAAYACLSPVIVWQSMLTYLLEQHYGLVLSDTEFSDDAVIHEHIDAGISLADALNFTVEKFDLARTDHRGF
SCQEQSPFITSIDILRARRATGLMTRMGYQTITSVIRGGKQA
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|