Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yfjZ-ypjF/CbtA-CbeA
Location 4333104..4333860 Replicon chromosome
Accession NZ_LR134160
Organism Yersinia pseudotuberculosis strain NCTC8480

Toxin (Protein)


Gene name ypjF Uniprot ID A0A3G5KDU1
Locus tag EL033_RS19755 Protein ID WP_032467110.1
Coordinates 4333104..4333472 (-) Length 123 a.a.

Antitoxin (Protein)


Gene name yfjZ Uniprot ID Q664A5
Locus tag EL033_RS19760 Protein ID WP_011193303.1
Coordinates 4333525..4333860 (-) Length 112 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL033_RS19720 4328184..4329191 + 1008 WP_011193296.1 iron chelate uptake ABC transporter family permease subunit -
EL033_RS19725 4329188..4329946 + 759 WP_011193297.1 ABC transporter ATP-binding protein -
EL033_RS19730 4329943..4330443 - 501 WP_002214364.1 virulence RhuM family protein -
EL033_RS19735 4330385..4330711 - 327 WP_011193298.1 hypothetical protein -
EL033_RS19740 4330734..4331141 - 408 WP_011193299.1 hypothetical protein -
EL033_RS19745 4331376..4331648 - 273 WP_011193300.1 Arm DNA-binding domain-containing protein -
EL033_RS19750 4332023..4332877 - 855 WP_032467109.1 DUF4942 domain-containing protein -
EL033_RS19755 4333104..4333472 - 369 WP_032467110.1 TA system toxin CbtA family protein Toxin
EL033_RS19760 4333525..4333860 - 336 WP_011193303.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
EL033_RS19765 4333872..4334351 - 480 WP_011193304.1 hypothetical protein -
EL033_RS19770 4334534..4335154 - 621 WP_011193305.1 hypothetical protein -
EL033_RS19775 4335182..4335736 - 555 WP_011193306.1 hypothetical protein -
EL033_RS19780 4335984..4336610 - 627 WP_024063555.1 hypothetical protein -
EL033_RS19785 4336664..4336957 - 294 Protein_3695 ATP-binding protein -
EL033_RS19790 4337622..4337858 + 237 Protein_3696 inovirus Gp2 family protein -
EL033_RS19795 4337924..4338706 - 783 WP_001317493.1 IS21-like element IS100kyp family helper ATPase IstB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 4322627..4347722 25095


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-111)

Antitoxin

Antitoxin CbeA

(7-106)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13723.81 Da        Isoelectric Point: 6.4530

>T286901 WP_032467110.1 NZ_LR134160:c4333472-4333104 [Yersinia pseudotuberculosis]
MQILPVTPKRAAYACPSPVVVWQSMLTYLLEQHYGLALNDTEFSDDAVIHEYIDAGISLSDALNFTVEKFGLVRIDRRGF
SCQEQSPFITAIDILRARRATGLMTRLGYQTIISVIRGEKQT

Download         Length: 369 bp

Antitoxin


Download         Length: 112 a.a.        Molecular weight: 12452.06 Da        Isoelectric Point: 6.0555

>AT286901 WP_011193303.1 NZ_LR134160:c4333860-4333525 [Yersinia pseudotuberculosis]
MPSITTPAWGLKRNVTPQFGARLVQEGDRLHFLADRADINGTFSEVQVRDLDNAFPQFINYLELMLLSGELNPRHQHCVT
LYRNGLTCEADSLGSHGYVYLAIYPTPQSTA

Download         Length: 336 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3G5KDU1

Antitoxin

Source ID Structure
AlphaFold DB Q664A5

References