Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
Location | 3624278..3624984 | Replicon | chromosome |
Accession | NZ_LR134152 | ||
Organism | Escherichia coli strain NCTC9104 |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | - |
Locus tag | EL040_RS17690 | Protein ID | WP_072186048.1 |
Coordinates | 3624278..3624646 (-) | Length | 123 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | - |
Locus tag | EL040_RS17695 | Protein ID | WP_054622944.1 |
Coordinates | 3624667..3624984 (-) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL040_RS17675 | 3621348..3622304 | + | 957 | WP_000121359.1 | molybdenum cofactor insertion chaperone PaoD | - |
EL040_RS17680 | 3622481..3623658 | + | 1178 | WP_085968792.1 | IS3 family transposase | - |
EL040_RS17685 | 3623667..3623954 | + | 288 | Protein_3442 | LysR family transcriptional regulator | - |
EL040_RS17690 | 3624278..3624646 | - | 369 | WP_072186048.1 | TA system toxin CbtA family protein | Toxin |
EL040_RS17695 | 3624667..3624984 | - | 318 | WP_054622944.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
EL040_RS17700 | 3625003..3625224 | - | 222 | WP_054622945.1 | DUF987 domain-containing protein | - |
EL040_RS17705 | 3625233..3625709 | - | 477 | WP_001548163.1 | RadC family protein | - |
EL040_RS17710 | 3625725..3626186 | - | 462 | WP_054622946.1 | antirestriction protein | - |
EL040_RS17715 | 3626200..3626391 | - | 192 | Protein_3448 | DUF905 domain-containing protein | - |
EL040_RS17725 | 3627957..3628838 | - | 882 | WP_054622947.1 | LysR family transcriptional regulator | - |
EL040_RS17730 | 3628835..3629527 | - | 693 | WP_032230813.1 | gamma-glutamylcyclotransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 3622283..3627821 | 5538 | |
- | inside | IScluster/Tn | - | - | 3622481..3627605 | 5124 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13824.00 Da Isoelectric Point: 8.2905
>T286890 WP_072186048.1 NZ_LR134152:c3624646-3624278 [Escherichia coli]
MKTLPATISRAAKPCLSPVAVWQMLLTRLLEKHYGLTLNDTPFWDQTVIQEHIDAGITLANVVNFLVEKHELVRIDRTGF
TSQEQAPYLTVTDILHARRACGLMNSCSYREVSNIVLSRSRQ
MKTLPATISRAAKPCLSPVAVWQMLLTRLLEKHYGLTLNDTPFWDQTVIQEHIDAGITLANVVNFLVEKHELVRIDRTGF
TSQEQAPYLTVTDILHARRACGLMNSCSYREVSNIVLSRSRQ
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|