Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 4294990..4295659 | Replicon | chromosome |
| Accession | NZ_LR134151 | ||
| Organism | Serratia plymuthica strain NCTC8900 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | EL066_RS20485 | Protein ID | WP_126485007.1 |
| Coordinates | 4294990..4295412 (-) | Length | 141 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | - |
| Locus tag | EL066_RS20490 | Protein ID | WP_126485009.1 |
| Coordinates | 4295393..4295659 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL066_RS20465 | 4290873..4291390 | + | 518 | Protein_3954 | flavodoxin FldB | - |
| EL066_RS20470 | 4291432..4292796 | - | 1365 | WP_126485003.1 | cell envelope integrity protein CreD | - |
| EL066_RS20475 | 4292881..4294299 | - | 1419 | WP_126485005.1 | two-component system sensor histidine kinase CreC | - |
| EL066_RS20480 | 4294296..4294993 | - | 698 | Protein_3957 | two-component system response regulator CreB | - |
| EL066_RS20485 | 4294990..4295412 | - | 423 | WP_126485007.1 | protein YgfX | Toxin |
| EL066_RS20490 | 4295393..4295659 | - | 267 | WP_126485009.1 | FAD assembly factor SdhE | Antitoxin |
| EL066_RS20495 | 4295984..4296976 | + | 993 | WP_126485011.1 | tRNA-modifying protein YgfZ | - |
| EL066_RS20500 | 4297062..4297739 | - | 678 | WP_126485013.1 | hemolysin III family protein | - |
| EL066_RS20505 | 4297929..4298537 | + | 609 | WP_126485015.1 | HD domain-containing protein | - |
| EL066_RS20510 | 4298579..4299514 | - | 936 | WP_126485017.1 | ribokinase | - |
| EL066_RS20515 | 4299511..4300418 | - | 908 | Protein_3964 | allose kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 16442.46 Da Isoelectric Point: 10.4481
>T286875 WP_126485007.1 NZ_LR134151:c4295412-4294990 [Serratia plymuthica]
VAQWRCNVRISWRTQLLSLLTHGVLILLILIAPWPEGYGPIWLVMLTLVVFECIRSQKRIASLQGELRLLANKRLSWHGQ
EWLLVKQPWMPRYGILLTLQPIQGKKPRRLWLASDSMGKAEWRHLRQLLQYPSADDDEEP
VAQWRCNVRISWRTQLLSLLTHGVLILLILIAPWPEGYGPIWLVMLTLVVFECIRSQKRIASLQGELRLLANKRLSWHGQ
EWLLVKQPWMPRYGILLTLQPIQGKKPRRLWLASDSMGKAEWRHLRQLLQYPSADDDEEP
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|