Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 3919413..3920068 | Replicon | chromosome |
Accession | NZ_LR134151 | ||
Organism | Serratia plymuthica strain NCTC8900 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | EL066_RS18735 | Protein ID | WP_126484530.1 |
Coordinates | 3919413..3919802 (-) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | EL066_RS18740 | Protein ID | WP_126484532.1 |
Coordinates | 3919805..3920068 (-) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL066_RS18720 | 3915889..3917322 | + | 1434 | WP_164713344.1 | MFS transporter | - |
EL066_RS18725 | 3917319..3918701 | + | 1383 | WP_126484528.1 | two-component system sensor histidine kinase BaeS | - |
EL066_RS18730 | 3918701..3919418 | + | 718 | Protein_3621 | two-component system response regulator BaeR | - |
EL066_RS18735 | 3919413..3919802 | - | 390 | WP_126484530.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
EL066_RS18740 | 3919805..3920068 | - | 264 | WP_126484532.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
EL066_RS18745 | 3920419..3920757 | + | 339 | WP_126484534.1 | YegP family protein | - |
EL066_RS18750 | 3921060..3922413 | + | 1354 | Protein_3625 | tRNA 5-hydroxyuridine modification protein YegQ | - |
EL066_RS18755 | 3922906..3923804 | + | 899 | Protein_3626 | lipid kinase YegS | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 14058.40 Da Isoelectric Point: 7.8817
>T286872 WP_126484530.1 NZ_LR134151:c3919802-3919413 [Serratia plymuthica]
MYMFDTNTVSHLFRRHPGLLSAMEKVPPSTVCISSITEAELLFGVAKRQSKALKAMVTAFLAAVTVYDWDSEAARCYGVM
RASMEKKGKVLGALDQLIAAHALSRGATMVTSDRAFGMVPGLDVEDWTL
MYMFDTNTVSHLFRRHPGLLSAMEKVPPSTVCISSITEAELLFGVAKRQSKALKAMVTAFLAAVTVYDWDSEAARCYGVM
RASMEKKGKVLGALDQLIAAHALSRGATMVTSDRAFGMVPGLDVEDWTL
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|