Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 3883339..3883806 Replicon chromosome
Accession NZ_LR134151
Organism Serratia plymuthica strain NCTC8900

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag EL066_RS18595 Protein ID WP_126484494.1
Coordinates 3883339..3883608 (-) Length 90 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag EL066_RS18600 Protein ID WP_126484496.1
Coordinates 3883612..3883806 (-) Length 65 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL066_RS18565 3878388..3878903 + 516 WP_126484492.1 E3 ubiquitin--protein ligase -
EL066_RS18570 3878942..3879190 + 249 WP_004951888.1 GlsB/YeaQ/YmgE family stress response membrane protein -
EL066_RS18575 3879240..3880518 - 1279 Protein_3591 uracil permease -
EL066_RS18580 3880722..3881346 - 625 Protein_3592 uracil phosphoribosyltransferase -
EL066_RS18585 3881610..3882647 + 1038 WP_006316901.1 phosphoribosylformylglycinamidine cyclo-ligase -
EL066_RS18590 3882647..3883285 + 639 WP_013814081.1 phosphoribosylglycinamide formyltransferase -
EL066_RS18595 3883339..3883608 - 270 WP_126484494.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
EL066_RS18600 3883612..3883806 - 195 WP_126484496.1 hypothetical protein Antitoxin
EL066_RS18605 3883953..3884504 + 552 WP_126484498.1 spermidine N1-acetyltransferase -
EL066_RS18610 3884917..3885504 + 588 WP_126484500.1 helix-turn-helix domain-containing protein -
EL066_RS18615 3885501..3886313 + 813 WP_126484502.1 queuosine precursor transporter -
EL066_RS18620 3886442..3887268 - 827 Protein_3600 IS256 family transposase -
EL066_RS18625 3887293..3888105 - 813 WP_006316912.1 phosphate ABC transporter ATP-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 3879521..3888105 8584


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-88)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 90 a.a.        Molecular weight: 10585.20 Da        Isoelectric Point: 6.4810

>T286871 WP_126484494.1 NZ_LR134151:c3883608-3883339 [Serratia plymuthica]
MRIEWSREAQEELWNIIDYIDDRNPQAALILQRGIETAVHSLSLNLFMYRLGRVDNTREIVVHPNYLIVYRIIGHIEVLS
VIHAKREYP

Download         Length: 270 bp

Antitoxin


Download         Length: 65 a.a.        Molecular weight: 7429.62 Da        Isoelectric Point: 10.2045

>AT286871 WP_126484496.1 NZ_LR134151:c3883806-3883612 [Serratia plymuthica]
MVIKTSLSTQPIAEVAEQGESYDRWFRAKIEAATNSEKPRVPHEQVMNEMQIRLAAKKKIRKME

Download         Length: 195 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References