286846

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TscAT/-
Location 847193..847725 Replicon chromosome
Accession NZ_LR134139
Organism Staphylococcus aureus strain NCTC4163

Toxin (Protein)


Gene name TscT Uniprot ID Q8VLW9
Locus tag ELZ55_RS04270 Protein ID WP_001103944.1
Coordinates 847405..847725 (+) Length 107 a.a.

Antitoxin (Protein)


Gene name TscA Uniprot ID X5IA75
Locus tag ELZ55_RS04265 Protein ID WP_001058492.1
Coordinates 847193..847402 (+) Length 70 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ELZ55_RS04230 842710..843930 - 1221 WP_000264181.1 site-specific integrase -
ELZ55_RS04235 844018..844746 - 729 WP_042727546.1 staphylococcal enterotoxin type K -
ELZ55_RS04240 844770..845498 - 729 WP_001033317.1 staphylococcal enterotoxin type Q -
ELZ55_RS04245 845673..846407 - 735 WP_000142630.1 helix-turn-helix domain-containing protein -
ELZ55_RS04250 846557..846769 + 213 WP_001063624.1 helix-turn-helix transcriptional regulator -
ELZ55_RS04255 846770..847042 + 273 WP_001138298.1 helix-turn-helix domain-containing protein -
ELZ55_RS04260 847054..847200 + 147 WP_012990927.1 hypothetical protein -
ELZ55_RS04265 847193..847402 + 210 WP_001058492.1 hypothetical protein Antitoxin
ELZ55_RS04270 847405..847725 + 321 WP_001103944.1 DUF1474 family protein Toxin
ELZ55_RS04275 847792..848661 + 870 WP_042727545.1 primase alpha helix C-terminal domain-containing protein -
ELZ55_RS04280 848678..850135 + 1458 WP_042727544.1 virulence-associated E family protein -
ELZ55_RS04285 850437..850799 + 363 WP_042727543.1 hypothetical protein -
ELZ55_RS04290 850801..851085 + 285 WP_042727542.1 hypothetical protein -
ELZ55_RS04295 851082..851723 + 642 WP_042727541.1 pathogenicity island protein -
ELZ55_RS04300 852297..852638 + 342 WP_042727540.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - vWbp / selk / selq 822745..856986 34241


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1474

(1-90)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 107 a.a.        Molecular weight: 12636.31 Da        Isoelectric Point: 4.8519

>T286846 WP_001103944.1 NZ_LR134139:847405-847725 [Staphylococcus aureus]
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLQVYLKEFDELIQKF
HEIEKASSDVSLATESDDAKKLKITE

Download         Length: 321 bp

Antitoxin


Download         Length: 70 a.a.        Molecular weight: 8238.28 Da        Isoelectric Point: 4.3718

>AT286846 WP_001058492.1 NZ_LR134139:847193-847402 [Staphylococcus aureus]
MNNEQKEVIEHVVYQLELSVMNNLESYEHTEYVNGIEVVSEISREKHLELIMKWCAQELKNNFQLEKGE

Download         Length: 210 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q8VLW9

Antitoxin

Source ID Structure
AlphaFold DB X5IA75

References