Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | TscAT/- |
| Location | 847193..847725 | Replicon | chromosome |
| Accession | NZ_LR134139 | ||
| Organism | Staphylococcus aureus strain NCTC4163 | ||
Toxin (Protein)
| Gene name | TscT | Uniprot ID | Q8VLW9 |
| Locus tag | ELZ55_RS04270 | Protein ID | WP_001103944.1 |
| Coordinates | 847405..847725 (+) | Length | 107 a.a. |
Antitoxin (Protein)
| Gene name | TscA | Uniprot ID | X5IA75 |
| Locus tag | ELZ55_RS04265 | Protein ID | WP_001058492.1 |
| Coordinates | 847193..847402 (+) | Length | 70 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ELZ55_RS04230 | 842710..843930 | - | 1221 | WP_000264181.1 | site-specific integrase | - |
| ELZ55_RS04235 | 844018..844746 | - | 729 | WP_042727546.1 | staphylococcal enterotoxin type K | - |
| ELZ55_RS04240 | 844770..845498 | - | 729 | WP_001033317.1 | staphylococcal enterotoxin type Q | - |
| ELZ55_RS04245 | 845673..846407 | - | 735 | WP_000142630.1 | helix-turn-helix domain-containing protein | - |
| ELZ55_RS04250 | 846557..846769 | + | 213 | WP_001063624.1 | helix-turn-helix transcriptional regulator | - |
| ELZ55_RS04255 | 846770..847042 | + | 273 | WP_001138298.1 | helix-turn-helix domain-containing protein | - |
| ELZ55_RS04260 | 847054..847200 | + | 147 | WP_012990927.1 | hypothetical protein | - |
| ELZ55_RS04265 | 847193..847402 | + | 210 | WP_001058492.1 | hypothetical protein | Antitoxin |
| ELZ55_RS04270 | 847405..847725 | + | 321 | WP_001103944.1 | DUF1474 family protein | Toxin |
| ELZ55_RS04275 | 847792..848661 | + | 870 | WP_042727545.1 | primase alpha helix C-terminal domain-containing protein | - |
| ELZ55_RS04280 | 848678..850135 | + | 1458 | WP_042727544.1 | virulence-associated E family protein | - |
| ELZ55_RS04285 | 850437..850799 | + | 363 | WP_042727543.1 | hypothetical protein | - |
| ELZ55_RS04290 | 850801..851085 | + | 285 | WP_042727542.1 | hypothetical protein | - |
| ELZ55_RS04295 | 851082..851723 | + | 642 | WP_042727541.1 | pathogenicity island protein | - |
| ELZ55_RS04300 | 852297..852638 | + | 342 | WP_042727540.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | vWbp / selk / selq | 822745..856986 | 34241 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12636.31 Da Isoelectric Point: 4.8519
>T286846 WP_001103944.1 NZ_LR134139:847405-847725 [Staphylococcus aureus]
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLQVYLKEFDELIQKF
HEIEKASSDVSLATESDDAKKLKITE
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLQVYLKEFDELIQKF
HEIEKASSDVSLATESDDAKKLKITE
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|