Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 829910..830387 Replicon chromosome
Accession NZ_LR134139
Organism Staphylococcus aureus strain NCTC4163

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag ELZ55_RS04125 Protein ID WP_000052076.1
Coordinates 829910..830098 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag ELZ55_RS04130 Protein ID WP_001059690.1
Coordinates 830127..830387 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ELZ55_RS04095 825952..826422 + 471 WP_000824472.1 hypothetical protein -
ELZ55_RS04100 826763..827449 + 687 WP_001548082.1 thermonuclease family protein -
ELZ55_RS04105 827806..828006 + 201 WP_001059082.1 cold-shock protein -
ELZ55_RS04110 828501..828719 - 219 WP_000005884.1 hypothetical protein -
ELZ55_RS04115 828781..829065 - 285 WP_001004394.1 hypothetical protein -
ELZ55_RS04120 829153..829722 - 570 WP_001106653.1 hypothetical protein -
ELZ55_RS04125 829910..830098 - 189 WP_000052076.1 hypothetical protein Toxin
ELZ55_RS04130 830127..830387 - 261 WP_001059690.1 hypothetical protein Antitoxin
ELZ55_RS04135 830728..830931 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
ELZ55_RS04140 830928..831164 - 237 WP_000368687.1 hypothetical protein -
ELZ55_RS04145 831389..831970 + 582 WP_001140697.1 phosphoglycerate mutase family protein -
ELZ55_RS04150 832043..832660 - 618 WP_000255553.1 LysE/ArgO family amino acid transporter -
ELZ55_RS04155 832815..833309 - 495 WP_000569884.1 GNAT family N-acetyltransferase -
ELZ55_RS04160 833708..834130 - 423 WP_000974460.1 organic hydroperoxide resistance protein -
ELZ55_RS04165 834278..834994 + 717 WP_000150013.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - vWbp / selk / selq 822745..856986 34241


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T286845 WP_000052076.1 NZ_LR134139:c830098-829910 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT286845 WP_001059690.1 NZ_LR134139:c830387-830127 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References