Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 2310911..2311529 | Replicon | chromosome |
| Accession | NZ_LR134138 | ||
| Organism | Kluyvera intermedia strain NCTC12125 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | A0A447MKF0 |
| Locus tag | EL028_RS11375 | Protein ID | WP_062773821.1 |
| Coordinates | 2311311..2311529 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | - |
| Locus tag | EL028_RS11370 | Protein ID | WP_062773820.1 |
| Coordinates | 2310911..2311285 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL028_RS11360 | 2305995..2307191 | + | 1197 | WP_062773816.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| EL028_RS11365 | 2307214..2310361 | + | 3148 | Protein_2203 | multidrug efflux RND transporter permease subunit AcrB | - |
| EL028_RS11370 | 2310911..2311285 | + | 375 | WP_062773820.1 | Hha toxicity modulator TomB | Antitoxin |
| EL028_RS11375 | 2311311..2311529 | + | 219 | WP_062773821.1 | hemolysin expression modulator Hha | Toxin |
| EL028_RS11380 | 2311670..2312224 | + | 555 | WP_062773823.1 | maltose O-acetyltransferase | - |
| EL028_RS11385 | 2312328..2312798 | + | 471 | WP_062774064.1 | YlaC family protein | - |
| EL028_RS11390 | 2312773..2314218 | - | 1446 | WP_062773825.1 | PLP-dependent aminotransferase family protein | - |
| EL028_RS11395 | 2314321..2315031 | + | 711 | WP_062773826.1 | GNAT family N-acetyltransferase | - |
| EL028_RS11400 | 2315028..2315168 | - | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
| EL028_RS11405 | 2315168..2315431 | - | 264 | WP_052283831.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8624.01 Da Isoelectric Point: 8.9008
>T286843 WP_062773821.1 NZ_LR134138:2311311-2311529 [Kluyvera intermedia]
MSDKPLTKTDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPTVWKFIR
MSDKPLTKTDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPTVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14311.05 Da Isoelectric Point: 4.8887
>AT286843 WP_062773820.1 NZ_LR134138:2310911-2311285 [Kluyvera intermedia]
MDEYSPKRHDIAQLKFLCETLYHDSLATLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYSEDNKLIAQIDEYL
DDTFMLFGNYGVNSDDLQKWRKSGNKLFRCFVNASRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDSLATLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYSEDNKLIAQIDEYL
DDTFMLFGNYGVNSDDLQKWRKSGNKLFRCFVNASRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|