Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3691972..3692638 | Replicon | chromosome |
Accession | NZ_LR134136 | ||
Organism | Atlantibacter hermannii strain NCTC12129 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A447LT15 |
Locus tag | EL032_RS17625 | Protein ID | WP_040459615.1 |
Coordinates | 3691972..3692391 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | H5V069 |
Locus tag | EL032_RS17630 | Protein ID | WP_002434469.1 |
Coordinates | 3692372..3692638 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL032_RS17605 (NCTC12129_04079) | 3687952..3689686 | - | 1735 | Protein_3475 | single-stranded-DNA-specific exonuclease RecJ | - |
EL032_RS17610 | 3689690..3690417 | - | 728 | Protein_3476 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
EL032_RS17615 | 3690443..3691345 | - | 903 | Protein_3477 | site-specific tyrosine recombinase XerD | - |
EL032_RS17620 (NCTC12129_04083) | 3691447..3691968 | + | 522 | WP_002434473.1 | flavodoxin FldB | - |
EL032_RS17625 (NCTC12129_04084) | 3691972..3692391 | - | 420 | WP_040459615.1 | protein YgfX | Toxin |
EL032_RS17630 (NCTC12129_04085) | 3692372..3692638 | - | 267 | WP_002434469.1 | FAD assembly factor SdhE | Antitoxin |
EL032_RS17635 (NCTC12129_04086) | 3692897..3693883 | + | 987 | WP_002434467.1 | tRNA-modifying protein YgfZ | - |
EL032_RS17640 (NCTC12129_04087) | 3694041..3694700 | - | 660 | WP_002434465.1 | hemolysin III family protein | - |
EL032_RS17645 (NCTC12129_04088) | 3694830..3695141 | - | 312 | WP_002434462.1 | N(4)-acetylcytidine aminohydrolase | - |
EL032_RS17650 (NCTC12129_04089) | 3695254..3695991 | + | 738 | WP_002434460.1 | MurR/RpiR family transcriptional regulator | - |
EL032_RS17655 (NCTC12129_04090) | 3696118..3697551 | + | 1434 | WP_002434459.1 | 6-phospho-beta-glucosidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 16511.44 Da Isoelectric Point: 10.5604
>T286838 WP_040459615.1 NZ_LR134136:c3692391-3691972 [Atlantibacter hermannii]
VVLWQSDLRVSWRAQWFSLMLHGIVAAIILLLPWPLSYMPLWLILLSLVVFDCVRSQRRIHSLQGEVKLTIDYRLRWQGI
EWELTAAPWMLQSGMLLRLRHPDTHRSQHLWLAADSMDAGEWRDLRRILMQQPQSGRHP
VVLWQSDLRVSWRAQWFSLMLHGIVAAIILLLPWPLSYMPLWLILLSLVVFDCVRSQRRIHSLQGEVKLTIDYRLRWQGI
EWELTAAPWMLQSGMLLRLRHPDTHRSQHLWLAADSMDAGEWRDLRRILMQQPQSGRHP
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A447LT15 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | H5V069 |