Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1186027..1186648 | Replicon | chromosome |
Accession | NZ_LR134136 | ||
Organism | Atlantibacter hermannii strain NCTC12129 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | EL032_RS05595 | Protein ID | WP_001291435.1 |
Coordinates | 1186027..1186245 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | H5UYE1 |
Locus tag | EL032_RS05600 | Protein ID | WP_002463720.1 |
Coordinates | 1186274..1186648 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL032_RS05560 (NCTC12129_01266) | 1181494..1181874 | + | 381 | WP_040459530.1 | hypothetical protein | - |
EL032_RS05565 (NCTC12129_01267) | 1182247..1182498 | + | 252 | WP_002463729.1 | hypothetical protein | - |
EL032_RS05570 (NCTC12129_01268) | 1182495..1182713 | + | 219 | WP_002463728.1 | hypothetical protein | - |
EL032_RS05575 | 1182852..1184404 | - | 1553 | Protein_1091 | EAL domain-containing protein | - |
EL032_RS05580 (NCTC12129_01271) | 1184659..1184919 | + | 261 | WP_002463724.1 | type B 50S ribosomal protein L31 | - |
EL032_RS05585 (NCTC12129_01272) | 1184922..1185062 | + | 141 | WP_061708247.1 | type B 50S ribosomal protein L36 | - |
EL032_RS05590 (NCTC12129_01273) | 1185098..1185564 | - | 467 | Protein_1094 | YlaC family protein | - |
EL032_RS05595 (NCTC12129_01275) | 1186027..1186245 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
EL032_RS05600 (NCTC12129_01276) | 1186274..1186648 | - | 375 | WP_002463720.1 | Hha toxicity modulator TomB | Antitoxin |
EL032_RS22090 (NCTC12129_01277) | 1187121..1187933 | - | 813 | WP_284515304.1 | efflux RND transporter permease subunit | - |
EL032_RS05605 (NCTC12129_01278) | 1188005..1190275 | - | 2271 | WP_284515254.1 | efflux RND transporter permease subunit | - |
EL032_RS05610 (NCTC12129_01279) | 1190298..1191494 | - | 1197 | WP_002463714.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T286831 WP_001291435.1 NZ_LR134136:c1186245-1186027 [Atlantibacter hermannii]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14380.16 Da Isoelectric Point: 5.1259
>AT286831 WP_002463720.1 NZ_LR134136:c1186648-1186274 [Atlantibacter hermannii]
MDEYSPKRHDIAQLKFLCENLYHDCLLTLGDSNHGWVNDPTSAINLQLNELIEHIASFALNYKIKHDEDNALIEHVDEYL
DDTFMLFSNYGISAQDLQKWRKSGNRLFRCFVNVSKANPVSLSF
MDEYSPKRHDIAQLKFLCENLYHDCLLTLGDSNHGWVNDPTSAINLQLNELIEHIASFALNYKIKHDEDNALIEHVDEYL
DDTFMLFSNYGISAQDLQKWRKSGNRLFRCFVNVSKANPVSLSF
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|