Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
Location | 970391..971043 | Replicon | chromosome |
Accession | NZ_LR134136 | ||
Organism | Atlantibacter hermannii strain NCTC12129 |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | H5V7Q7 |
Locus tag | EL032_RS04590 | Protein ID | WP_002438660.1 |
Coordinates | 970391..970705 (-) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | H5V7Q6 |
Locus tag | EL032_RS04595 | Protein ID | WP_002438659.1 |
Coordinates | 970726..971043 (-) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL032_RS04565 (NCTC12129_01045) | 965423..966677 | + | 1255 | Protein_894 | glutamate-5-semialdehyde dehydrogenase | - |
EL032_RS04575 (NCTC12129_01048) | 967278..968279 | + | 1002 | WP_002438595.1 | BsuBI/PstI family type II restriction endonuclease | - |
EL032_RS04580 (NCTC12129_01049) | 968329..969858 | - | 1530 | WP_002438597.1 | Eco57I restriction-modification methylase domain-containing protein | - |
EL032_RS04585 (NCTC12129_01050) | 969991..970251 | - | 261 | Protein_897 | restriction endonuclease subunit M | - |
EL032_RS04590 (NCTC12129_01051) | 970391..970705 | - | 315 | WP_002438660.1 | TA system toxin CbtA family protein | Toxin |
EL032_RS04595 (NCTC12129_01052) | 970726..971043 | - | 318 | WP_002438659.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
EL032_RS04600 (NCTC12129_01053) | 971062..971283 | - | 222 | WP_000691995.1 | DUF987 domain-containing protein | - |
EL032_RS04605 (NCTC12129_01054) | 971292..971768 | - | 477 | WP_002438657.1 | RadC family protein | - |
EL032_RS04610 (NCTC12129_01055) | 971784..972242 | - | 459 | WP_002438656.1 | antirestriction protein | - |
EL032_RS04615 | 972351..972578 | - | 228 | WP_081479374.1 | DUF905 domain-containing protein | - |
EL032_RS04620 | 972741..973274 | - | 534 | Protein_904 | DeoR family transcriptional regulator | - |
EL032_RS04625 (NCTC12129_01057) | 973491..974312 | - | 822 | WP_002438653.1 | DUF932 domain-containing protein | - |
EL032_RS04630 (NCTC12129_01058) | 974404..975268 | - | 865 | Protein_906 | GTPase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 969898..1019092 | 49194 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11636.46 Da Isoelectric Point: 6.4533
>T286830 WP_002438660.1 NZ_LR134136:c970705-970391 [Atlantibacter hermannii]
MKTLPATTPQAAKLCLPPVAVWQMLLARLLEQHYGLTLNDTSFSDETVIQEHIDAGITLADAVNFLVDKYELVRIDRRGL
SWQAQSSYLRAVDILRARQATGLL
MKTLPATTPQAAKLCLPPVAVWQMLLARLLEQHYGLTLNDTSFSDETVIQEHIDAGITLADAVNFLVDKYELVRIDRRGL
SWQAQSSYLRAVDILRARQATGLL
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|