Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 312750..313336 Replicon chromosome
Accession NZ_LR134136
Organism Atlantibacter hermannii strain NCTC12129

Toxin (Protein)


Gene name doc Uniprot ID H5V3H7
Locus tag EL032_RS01435 Protein ID WP_002436531.1
Coordinates 312968..313336 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID H5V3H8
Locus tag EL032_RS01430 Protein ID WP_002436532.1
Coordinates 312750..312971 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL032_RS01405 (NCTC12129_00323) 307831..308946 + 1116 WP_040459974.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
EL032_RS01410 (NCTC12129_00324) 308982..309908 + 927 WP_002436536.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
EL032_RS01415 (NCTC12129_00326) 309905..311181 + 1277 Protein_280 high-affinity branched-chain amino acid ABC transporter permease LivM -
EL032_RS01420 (NCTC12129_00328) 311178..311947 + 770 Protein_281 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
EL032_RS01425 (NCTC12129_00330) 311949..312663 + 715 Protein_282 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
EL032_RS01430 (NCTC12129_00331) 312750..312971 + 222 WP_002436532.1 type II toxin-antitoxin system prevent-host-death family antitoxin Antitoxin
EL032_RS01435 (NCTC12129_00332) 312968..313336 + 369 WP_002436531.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
EL032_RS01440 (NCTC12129_00333) 313514..314827 + 1314 WP_002436529.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
EL032_RS01445 (NCTC12129_00334) 314888..315775 + 888 WP_002436527.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
EL032_RS01450 (NCTC12129_00335) 315772..316617 + 846 WP_002436525.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
EL032_RS01455 (NCTC12129_00336) 316627..317694 + 1068 WP_002436522.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 312013..318431 6418


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(30-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-53)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13599.99 Da        Isoelectric Point: 9.9883

>T286829 WP_002436531.1 NZ_LR134136:312968-313336 [Atlantibacter hermannii]
MTIQFISAEEIIRFHDRLLAVTPGVPGMVDPGRAEALLYRVLNKYKYEGVNDLWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGITLPANPAFVELTVAAAAGQLSLEEIARQLRK

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8091.20 Da        Isoelectric Point: 5.6512

>AT286829 WP_002436532.1 NZ_LR134136:312750-312971 [Atlantibacter hermannii]
MQTMNYSEARQNLAAALETAALGTPVTITRRGHKPAVIISAEEFERYQQAKMDAEFAAIMAIHGNEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB H5V3H7

Antitoxin

Source ID Structure
AlphaFold DB H5V3H8

References