Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 2501289..2501961 | Replicon | chromosome |
Accession | NZ_LR134117 | ||
Organism | Serratia odorifera strain NCTC11214 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A3S5D7F3 |
Locus tag | EL065_RS12170 | Protein ID | WP_039991778.1 |
Coordinates | 2501536..2501961 (+) | Length | 142 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | D4E228 |
Locus tag | EL065_RS12165 | Protein ID | WP_004959027.1 |
Coordinates | 2501289..2501555 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL065_RS12140 | 2496357..2497676 | + | 1320 | WP_004959017.1 | MHS family MFS transporter | - |
EL065_RS12145 | 2497791..2498399 | - | 609 | WP_004959018.1 | HD domain-containing protein | - |
EL065_RS12150 | 2498594..2499268 | + | 675 | WP_039992574.1 | hemolysin III family protein | - |
EL065_RS12155 | 2499422..2499922 | + | 501 | WP_004959022.1 | DUF2165 domain-containing protein | - |
EL065_RS12160 | 2499977..2500966 | - | 990 | WP_004959025.1 | tRNA-modifying protein YgfZ | - |
EL065_RS12165 | 2501289..2501555 | + | 267 | WP_004959027.1 | FAD assembly factor SdhE | Antitoxin |
EL065_RS12170 | 2501536..2501961 | + | 426 | WP_039991778.1 | membrane protein | Toxin |
EL065_RS12175 | 2501961..2502656 | + | 696 | WP_004959031.1 | two-component system response regulator CreB | - |
EL065_RS12180 | 2502653..2504092 | + | 1440 | WP_004959033.1 | two-component system sensor histidine kinase CreC | - |
EL065_RS12185 | 2504156..2505485 | + | 1330 | Protein_2351 | cell envelope integrity protein CreD | - |
EL065_RS12190 | 2505526..2506044 | - | 519 | WP_004959039.1 | flavodoxin FldB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 16522.38 Da Isoelectric Point: 10.9205
>T286824 WP_039991778.1 NZ_LR134117:2501536-2501961 [Serratia odorifera]
VAQWRCNVRISWRTQIVSLLAHGALILLILISPWPEGYGPLWLVLLTLVVFECIRSQKRIATRQGELRVLSAPRHVVWDG
QEWRVIGRPWMPRFGILFTLEPLDGQKRRRLWLASDCMSKADWRQLRQRLSFPPEDDSEAP
VAQWRCNVRISWRTQIVSLLAHGALILLILISPWPEGYGPLWLVLLTLVVFECIRSQKRIATRQGELRVLSAPRHVVWDG
QEWRVIGRPWMPRFGILFTLEPLDGQKRRRLWLASDCMSKADWRQLRQRLSFPPEDDSEAP
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3S5D7F3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3S4EAY2 |