Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 327690..328313 Replicon chromosome
Accession NZ_LR134117
Organism Serratia odorifera strain NCTC11214

Toxin (Protein)


Gene name Hha Uniprot ID -
Locus tag EL065_RS01750 Protein ID WP_088499884.1
Coordinates 328110..328313 (+) Length 68 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID D4DW80
Locus tag EL065_RS01745 Protein ID WP_004954559.1
Coordinates 327690..328058 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL065_RS01715 323738..323992 + 255 WP_004954539.1 type B 50S ribosomal protein L31 -
EL065_RS01720 324004..324144 + 141 WP_004954542.1 type B 50S ribosomal protein L36 -
EL065_RS01725 324263..325142 - 880 Protein_344 metal ABC transporter substrate-binding protein -
EL065_RS01730 325169..326026 - 858 WP_004954548.1 metal ABC transporter permease -
EL065_RS01735 326023..326736 - 714 WP_004954551.1 ABC transporter ATP-binding protein -
EL065_RS25485 326733..326879 - 147 WP_004954554.1 hypothetical protein -
EL065_RS01740 327178..327531 + 354 WP_004954558.1 hypothetical protein -
EL065_RS01745 327690..328058 + 369 WP_004954559.1 Hha toxicity modulator TomB Antitoxin
EL065_RS01750 328110..328313 + 204 WP_088499884.1 hemolysin expression modulator Hha Toxin
EL065_RS01760 329052..329369 + 318 WP_039991041.1 MGMT family protein -
EL065_RS01765 329433..329927 - 495 WP_004954567.1 YbaY family lipoprotein -
EL065_RS01770 330157..331020 + 864 WP_004954570.1 acyl-CoA thioesterase II -
EL065_RS01775 331122..332409 - 1288 Protein_354 ammonium transporter AmtB -
EL065_RS01780 332446..332784 - 339 WP_004949337.1 P-II family nitrogen regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(8-64)

Antitoxin

Biofilm formation regulator YbaJ

(1-118)


Sequences

Toxin        


Download         Length: 68 a.a.        Molecular weight: 8089.39 Da        Isoelectric Point: 6.9756

>T286822 WP_088499884.1 NZ_LR134117:328110-328313 [Serratia odorifera]
MTKIDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKVPTAVWKYVR

Download         Length: 204 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 14222.96 Da        Isoelectric Point: 4.5140

>AT286822 WP_004954559.1 NZ_LR134117:327690-328058 [Serratia odorifera]
MDEYSPKRHDIAQLKFLCETLYDEGIATLGDSHHGWVNDPTSAVNLQLNELIEHIASFIMSYKIKYMDESDFSELVEEYL
DDTYTLFSSYGINDSDLRRWQKTKARLFRMFSGEGICTTMKT

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A3S4EN85

References