Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 115291..115931 Replicon chromosome
Accession NZ_LR134117
Organism Serratia odorifera strain NCTC11214

Toxin (Protein)


Gene name vagD Uniprot ID D4E9X2
Locus tag EL065_RS00645 Protein ID WP_004966053.1
Coordinates 115515..115931 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID -
Locus tag EL065_RS00640 Protein ID WP_039992944.1
Coordinates 115291..115518 (+) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL065_RS00610 110420..111391 - 972 WP_004966041.1 ParB/RepB/Spo0J family partition protein -
EL065_RS00615 111400..112593 - 1194 WP_039992918.1 AAA family ATPase -
EL065_RS00620 112910..113152 + 243 WP_004966044.1 type II toxin-antitoxin system RelB/DinJ family antitoxin -
EL065_RS00625 113142..113429 + 288 WP_004966046.1 type II toxin-antitoxin system RelE/ParE family toxin -
EL065_RS00630 113673..114371 - 699 WP_102991064.1 tyrosine-type recombinase/integrase -
EL065_RS00635 114482..114766 - 285 WP_004966050.1 hypothetical protein -
EL065_RS00640 115291..115518 + 228 WP_039992944.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
EL065_RS00645 115515..115931 + 417 WP_004966053.1 type II toxin-antitoxin system VapC family toxin Toxin
EL065_RS00650 116255..116684 - 430 Protein_130 IS6 family transposase -
EL065_RS00655 116822..117793 - 972 WP_004966062.1 hypothetical protein -
EL065_RS00660 117790..118086 - 297 WP_193764789.1 hypothetical protein -
EL065_RS00665 118153..118938 - 786 Protein_133 IS66 family transposase -
EL065_RS00670 119027..120277 - 1251 WP_004966413.1 group II intron reverse transcriptase/maturase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - gtrB 28996..266260 237264


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-54)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15249.63 Da        Isoelectric Point: 8.2887

>T286820 WP_004966053.1 NZ_LR134117:115515-115931 [Serratia odorifera]
MKKTYMLDTNICSFIMREQPEAVIHRLQQCALRNNRIVVSAITYAEMRFGAIGKKASPRHGLLVDAFCQRLDAVLPWDRA
AVDATTTVRQALAAAGTPIGGNDAAIAGHAISTDAILVTNNVREFERVPTLLWEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8677.83 Da        Isoelectric Point: 4.4692

>AT286820 WP_039992944.1 NZ_LR134117:115291-115518 [Serratia odorifera]
MRTVAIFKNGSNRAIRLPRDMDFDGVNELEIVREGDTLILRPVKPSWNSFLSEENADSDFMVERPDIIEEGRVRL

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3S4DS32

Antitoxin

Source ID Structure

References