Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-RelB
Location 112910..113429 Replicon chromosome
Accession NZ_LR134117
Organism Serratia odorifera strain NCTC11214

Toxin (Protein)


Gene name relE Uniprot ID D4E9W8
Locus tag EL065_RS00625 Protein ID WP_004966046.1
Coordinates 113142..113429 (+) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID D4E9W7
Locus tag EL065_RS00620 Protein ID WP_004966044.1
Coordinates 112910..113152 (+) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL065_RS00595 108907..109467 - 561 WP_088499560.1 IS66 family transposase zinc-finger binding domain-containing protein -
EL065_RS00600 109532..109870 - 339 WP_004966475.1 IS66 family insertion sequence element accessory protein TnpB -
EL065_RS00605 109864..110193 - 330 WP_004966472.1 hypothetical protein -
EL065_RS00610 110420..111391 - 972 WP_004966041.1 ParB/RepB/Spo0J family partition protein -
EL065_RS00615 111400..112593 - 1194 WP_039992918.1 AAA family ATPase -
EL065_RS00620 112910..113152 + 243 WP_004966044.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
EL065_RS00625 113142..113429 + 288 WP_004966046.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
EL065_RS00630 113673..114371 - 699 WP_102991064.1 tyrosine-type recombinase/integrase -
EL065_RS00635 114482..114766 - 285 WP_004966050.1 hypothetical protein -
EL065_RS00640 115291..115518 + 228 WP_039992944.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
EL065_RS00645 115515..115931 + 417 WP_004966053.1 type II toxin-antitoxin system VapC family toxin -
EL065_RS00650 116255..116684 - 430 Protein_130 IS6 family transposase -
EL065_RS00655 116822..117793 - 972 WP_004966062.1 hypothetical protein -
EL065_RS00660 117790..118086 - 297 WP_193764789.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - gtrB 28996..266260 237264


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-83)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(2-72)


Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11008.92 Da        Isoelectric Point: 10.1715

>T286819 WP_004966046.1 NZ_LR134117:113142-113429 [Serratia odorifera]
MTYKIDFDNAAFKEWKKLGETVRQQFKKKLAQIVEAPHIEANRLHSLPDCYKIKLRASGYRLVYKVEDETVVILVLAVGK
RERLEVYKAAATRLG

Download         Length: 288 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8744.06 Da        Isoelectric Point: 4.3951

>AT286819 WP_004966044.1 NZ_LR134117:112910-113152 [Serratia odorifera]
MGTMNIRIDDDLKARAGVALDGLGITASEAVRMVLEYVAQNNRLPVQVALLADEDADIIELARERLANPGKRIRVTLDDL

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A447KK12

Antitoxin

Source ID Structure
AlphaFold DB A0A7Y9C138

References