Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 30136..30761 | Replicon | chromosome |
| Accession | NZ_LR134117 | ||
| Organism | Serratia odorifera strain NCTC11214 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | EL065_RS00170 | Protein ID | WP_004966176.1 |
| Coordinates | 30363..30761 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | D4EA25 |
| Locus tag | EL065_RS00165 | Protein ID | WP_004966175.1 |
| Coordinates | 30136..30363 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL065_RS00165 | 30136..30363 | + | 228 | WP_004966175.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| EL065_RS00170 | 30363..30761 | + | 399 | WP_004966176.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| EL065_RS00175 | 30820..31500 | - | 681 | WP_004966177.1 | relaxase domain-containing protein | - |
| EL065_RS00180 | 31586..33853 | - | 2268 | WP_004966178.1 | type IV conjugative transfer system coupling protein TraD | - |
| EL065_RS00185 | 33843..34052 | - | 210 | WP_039992934.1 | hypothetical protein | - |
| EL065_RS00190 | 34054..34584 | - | 531 | WP_004966180.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | gtrB | 28996..266260 | 237264 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14781.05 Da Isoelectric Point: 7.1074
>T286818 WP_004966176.1 NZ_LR134117:30363-30761 [Serratia odorifera]
MLKYLLDTNTCIFTIKNKPTLVRERFNLNTSRLCISSVTLMELIYGAEKSQAPERNLAVLEGFIARLDVLNYDAAAAAHS
GQIRAELSRQGLPIGPFDLMIAGHARSQGLIVVTNNTREFERVDGLRIEDWC
MLKYLLDTNTCIFTIKNKPTLVRERFNLNTSRLCISSVTLMELIYGAEKSQAPERNLAVLEGFIARLDVLNYDAAAAAHS
GQIRAELSRQGLPIGPFDLMIAGHARSQGLIVVTNNTREFERVDGLRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|