Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-RelB |
Location | 4618070..4618652 | Replicon | chromosome |
Accession | NZ_LR134116 | ||
Organism | Yersinia intermedia strain NCTC11469 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | EL015_RS21070 | Protein ID | WP_005186844.1 |
Coordinates | 4618362..4618652 (+) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A0T9ML19 |
Locus tag | EL015_RS21065 | Protein ID | WP_032906763.1 |
Coordinates | 4618070..4618351 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL015_RS21045 | 4613195..4614049 | + | 855 | WP_005186854.1 | formate dehydrogenase accessory sulfurtransferase FdhD | - |
EL015_RS21050 | 4614174..4614794 | + | 621 | WP_032906754.1 | superoxide dismutase [Mn] | - |
EL015_RS21055 | 4615189..4617150 | + | 1962 | WP_005186851.1 | methyl-accepting chemotaxis protein | - |
EL015_RS21060 | 4617294..4617968 | + | 675 | WP_005186847.1 | 6-N-hydroxylaminopurine resistance protein | - |
EL015_RS21065 | 4618070..4618351 | + | 282 | WP_032906763.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
EL015_RS21070 | 4618362..4618652 | + | 291 | WP_005186844.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
EL015_RS21075 | 4618718..4619074 | - | 357 | WP_005186841.1 | YibL family ribosome-associated protein | - |
EL015_RS21080 | 4619167..4620648 | - | 1482 | WP_032906752.1 | PLP-dependent aminotransferase family protein | - |
EL015_RS21085 | 4620864..4621472 | + | 609 | WP_032906751.1 | LysE family translocator | - |
EL015_RS21090 | 4621474..4622028 | - | 555 | WP_005186837.1 | MltR family transcriptional regulator | - |
EL015_RS21095 | 4622210..4623373 | - | 1164 | WP_005186836.1 | mannitol-1-phosphate 5-dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11249.86 Da Isoelectric Point: 6.8695
>T286817 WP_005186844.1 NZ_LR134116:4618362-4618652 [Yersinia intermedia]
MPRTADYTKDFLKDWERLSRSGRYDMYRLKHAMLLLIANDTPLGAEWLDHPLKGDWENFRECHIGGDFLLIYKLSSSSKI
SQIIFVRAGTHSELFD
MPRTADYTKDFLKDWERLSRSGRYDMYRLKHAMLLLIANDTPLGAEWLDHPLKGDWENFRECHIGGDFLLIYKLSSSSKI
SQIIFVRAGTHSELFD
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|