Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeV-yfjZ/CbtA-CbeA |
Location | 4080837..4081537 | Replicon | chromosome |
Accession | NZ_LR134116 | ||
Organism | Yersinia intermedia strain NCTC11469 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | - |
Locus tag | EL015_RS18640 | Protein ID | WP_005186647.1 |
Coordinates | 4081166..4081537 (-) | Length | 124 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | - |
Locus tag | EL015_RS18635 | Protein ID | WP_032906673.1 |
Coordinates | 4080837..4081169 (-) | Length | 111 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL015_RS18620 | 4077961..4078758 | - | 798 | WP_005186659.1 | tetratricopeptide repeat protein | - |
EL015_RS18625 | 4079009..4079683 | - | 675 | WP_005186657.1 | DUF2625 domain-containing protein | - |
EL015_RS18630 | 4079892..4080752 | - | 861 | WP_005186655.1 | DUF4942 domain-containing protein | - |
EL015_RS18635 | 4080837..4081169 | - | 333 | WP_032906673.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
EL015_RS18640 | 4081166..4081537 | - | 372 | WP_005186647.1 | TA system toxin CbtA family protein | Toxin |
EL015_RS18645 | 4081673..4082158 | - | 486 | WP_005186643.1 | DNA repair protein RadC | - |
EL015_RS18650 | 4082178..4082609 | - | 432 | WP_005186639.1 | antirestriction protein | - |
EL015_RS18655 | 4082965..4083786 | - | 822 | WP_032906671.1 | DUF945 domain-containing protein | - |
EL015_RS18660 | 4083935..4084372 | - | 438 | WP_005186633.1 | hypothetical protein | - |
EL015_RS18665 | 4084429..4084983 | - | 555 | WP_005186631.1 | hypothetical protein | - |
EL015_RS18670 | 4085287..4086171 | - | 885 | WP_126286801.1 | 50S ribosome-binding GTPase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13746.84 Da Isoelectric Point: 7.3134
>T286816 WP_005186647.1 NZ_LR134116:c4081537-4081166 [Yersinia intermedia]
MKPRPTSPGALPVPIIYQQLLAFLLEHYYGLSLNDTPYHDEQVIAQQIEREISVGDTINALVDKYVLVRIGRNGFSALAQ
DPMLSKGDIARARQAAGLWRAHFPPTLLYPTESLNPIPQRPLT
MKPRPTSPGALPVPIIYQQLLAFLLEHYYGLSLNDTPYHDEQVIAQQIEREISVGDTINALVDKYVLVRIGRNGFSALAQ
DPMLSKGDIARARQAAGLWRAHFPPTLLYPTESLNPIPQRPLT
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|