Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3445401..3446020 | Replicon | chromosome |
Accession | NZ_LR134116 | ||
Organism | Yersinia intermedia strain NCTC11469 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | Q66DR5 |
Locus tag | EL015_RS15895 | Protein ID | WP_002208622.1 |
Coordinates | 3445817..3446020 (+) | Length | 68 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | A0A0T9M685 |
Locus tag | EL015_RS15890 | Protein ID | WP_005182270.1 |
Coordinates | 3445401..3445769 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL015_RS15860 | 3441032..3441304 | + | 273 | WP_032905607.1 | type B 50S ribosomal protein L31 | - |
EL015_RS15865 | 3441307..3441450 | + | 144 | WP_002208618.1 | type B 50S ribosomal protein L36 | - |
EL015_RS15870 | 3441617..3442495 | - | 879 | WP_005182278.1 | metal ABC transporter substrate-binding protein | - |
EL015_RS15875 | 3442524..3443381 | - | 858 | WP_032905605.1 | metal ABC transporter permease | - |
EL015_RS15880 | 3443378..3444115 | - | 738 | WP_050073470.1 | ABC transporter ATP-binding protein | - |
EL015_RS15885 | 3444889..3445242 | + | 354 | WP_032905603.1 | hypothetical protein | - |
EL015_RS15890 | 3445401..3445769 | + | 369 | WP_005182270.1 | Hha toxicity modulator TomB | Antitoxin |
EL015_RS15895 | 3445817..3446020 | + | 204 | WP_002208622.1 | expression modulating protein YmoA | Toxin |
EL015_RS15905 | 3446949..3447254 | + | 306 | WP_186004081.1 | MGMT family protein | - |
EL015_RS15910 | 3447345..3447899 | - | 555 | WP_005182263.1 | YbaY family lipoprotein | - |
EL015_RS15915 | 3448158..3449018 | + | 861 | WP_005182259.1 | acyl-CoA thioesterase II | - |
EL015_RS15920 | 3449098..3450387 | - | 1290 | WP_032905738.1 | ammonium transporter AmtB | - |
EL015_RS15925 | 3450427..3450765 | - | 339 | WP_002208627.1 | P-II family nitrogen regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8063.31 Da Isoelectric Point: 6.4573
>T286815 WP_002208622.1 NZ_LR134116:3445817-3446020 [Yersinia intermedia]
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPPTVWQHVK
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPPTVWQHVK
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14222.93 Da Isoelectric Point: 4.4314
>AT286815 WP_005182270.1 NZ_LR134116:3445401-3445769 [Yersinia intermedia]
MDEYSPKRHDIAQLKFLCESLYDEGIATLGDSHHGWVNDPTSAVNLQLNDLIEHIASFVMSFKIKYPDDGDLSELVEEYL
DDTYTLFSSYGINDPELRRWQKTKERLFRLFSGEYTCTLMKT
MDEYSPKRHDIAQLKFLCESLYDEGIATLGDSHHGWVNDPTSAVNLQLNDLIEHIASFVMSFKIKYPDDGDLSELVEEYL
DDTYTLFSSYGINDPELRRWQKTKERLFRLFSGEYTCTLMKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|