Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 1323921..1324456 | Replicon | chromosome |
Accession | NZ_LR134116 | ||
Organism | Yersinia intermedia strain NCTC11469 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | EL015_RS06155 | Protein ID | WP_032905972.1 |
Coordinates | 1324169..1324456 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A0T9M846 |
Locus tag | EL015_RS06150 | Protein ID | WP_032905973.1 |
Coordinates | 1323921..1324172 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL015_RS06125 | 1319348..1319851 | + | 504 | WP_032905979.1 | ferredoxin-type protein NapF | - |
EL015_RS06130 | 1319841..1320107 | + | 267 | WP_032905977.1 | chaperone NapD | - |
EL015_RS06135 | 1320104..1322599 | + | 2496 | WP_032905975.1 | nitrate reductase catalytic subunit NapA | - |
EL015_RS06140 | 1322695..1323162 | + | 468 | WP_032905974.1 | nitrate reductase cytochrome c-type subunit | - |
EL015_RS06145 | 1323191..1323790 | + | 600 | WP_005183830.1 | cytochrome c-type protein NapC | - |
EL015_RS06150 | 1323921..1324172 | + | 252 | WP_032905973.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
EL015_RS06155 | 1324169..1324456 | + | 288 | WP_032905972.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EL015_RS06160 | 1324486..1325061 | + | 576 | WP_032906016.1 | GDP-mannose pyrophosphatase NudK | - |
EL015_RS06165 | 1325397..1327676 | + | 2280 | WP_005183822.1 | NADP-dependent oxaloacetate-decarboxylating malate dehydrogenase | - |
EL015_RS06170 | 1327763..1328218 | - | 456 | WP_032905970.1 | YaiI/YqxD family protein | - |
EL015_RS06175 | 1328218..1329144 | - | 927 | WP_005183819.1 | oxygen-dependent coproporphyrinogen oxidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11130.05 Da Isoelectric Point: 10.3510
>T286809 WP_032905972.1 NZ_LR134116:1324169-1324456 [Yersinia intermedia]
MTYAVKFREEALKEWHKLDKTIQQQFAKKLKKCSDNPHIESAKLRGMKNCYKIKLRSSGFRLVYEIIDDVLIVAVVAVGK
RDRSEVYNLASDRLR
MTYAVKFREEALKEWHKLDKTIQQQFAKKLKKCSDNPHIESAKLRGMKNCYKIKLRSSGFRLVYEIIDDVLIVAVVAVGK
RDRSEVYNLASDRLR
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|