Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 897771..898446 | Replicon | chromosome |
Accession | NZ_LR134116 | ||
Organism | Yersinia intermedia strain NCTC11469 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A0T9MA63 |
Locus tag | EL015_RS04150 | Protein ID | WP_032908006.1 |
Coordinates | 898018..898446 (+) | Length | 143 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | A0A0T9M975 |
Locus tag | EL015_RS04145 | Protein ID | WP_005193092.1 |
Coordinates | 897771..898037 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL015_RS04125 | 893931..894680 | + | 750 | WP_005193105.1 | SDR family oxidoreductase | - |
EL015_RS04130 | 894742..895350 | - | 609 | WP_005193102.1 | HD domain-containing protein | - |
EL015_RS04135 | 895705..896355 | + | 651 | WP_005193099.1 | hemolysin III family protein | - |
EL015_RS04140 | 896413..897405 | - | 993 | WP_005193095.1 | tRNA-modifying protein YgfZ | - |
EL015_RS04145 | 897771..898037 | + | 267 | WP_005193092.1 | FAD assembly factor SdhE | Antitoxin |
EL015_RS04150 | 898018..898446 | + | 429 | WP_032908006.1 | protein YgfX | Toxin |
EL015_RS04155 | 898443..899138 | + | 696 | WP_032908003.1 | two-component system response regulator CreB | - |
EL015_RS04160 | 899166..900593 | + | 1428 | WP_032906548.1 | two-component system sensor histidine kinase CreC | - |
EL015_RS04165 | 900686..902092 | + | 1407 | WP_005185995.1 | cell envelope integrity protein CreD | - |
EL015_RS04170 | 902143..902661 | - | 519 | WP_005185992.1 | flavodoxin FldB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 143 a.a. Molecular weight: 16529.42 Da Isoelectric Point: 10.3815
>T286808 WP_032908006.1 NZ_LR134116:898018-898446 [Yersinia intermedia]
VAQWRCDLRVSWHTQLFSLLSHGVLVILTLVAPWPQGYTALWLVLLTLVVFECIRSQKNITSCQGEIRLKPGNLVLWKRL
EWIVVKQPWITRYGVLLNLQQSSSRSARKRLWLAADSMSEDEWRQLCLLLRHSFGSDKGMNQ
VAQWRCDLRVSWHTQLFSLLSHGVLVILTLVAPWPQGYTALWLVLLTLVVFECIRSQKNITSCQGEIRLKPGNLVLWKRL
EWIVVKQPWITRYGVLLNLQQSSSRSARKRLWLAADSMSEDEWRQLCLLLRHSFGSDKGMNQ
Download Length: 429 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0T9MA63 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0T9M975 |