Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeV-yfjZ/CbtA-CbeA |
Location | 606268..606990 | Replicon | chromosome |
Accession | NZ_LR134116 | ||
Organism | Yersinia intermedia strain NCTC11469 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | - |
Locus tag | EL015_RS02780 | Protein ID | WP_005190380.1 |
Coordinates | 606670..606990 (+) | Length | 107 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | - |
Locus tag | EL015_RS02775 | Protein ID | WP_032907452.1 |
Coordinates | 606268..606603 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL015_RS02760 | 601922..603628 | - | 1707 | WP_032907453.1 | hypothetical protein | - |
EL015_RS02765 | 603612..605354 | - | 1743 | WP_005190390.1 | hypothetical protein | - |
EL015_RS02770 | 605775..606254 | + | 480 | WP_005190387.1 | DNA repair protein RadC | - |
EL015_RS02775 | 606268..606603 | + | 336 | WP_032907452.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
EL015_RS02780 | 606670..606990 | + | 321 | WP_005190380.1 | TA system toxin CbtA family protein | Toxin |
EL015_RS02785 | 607104..607943 | + | 840 | WP_005190376.1 | DUF4942 domain-containing protein | - |
EL015_RS02795 | 608330..610168 | - | 1839 | WP_005190373.1 | RNA polymerase sigma factor RpoD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 603612..613972 | 10360 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12054.72 Da Isoelectric Point: 6.0591
>T286806 WP_005190380.1 NZ_LR134116:606670-606990 [Yersinia intermedia]
MQISTVPATVLVSSRLSPVQVWQQLLTYLLEHHYGLTLNDTPFHDDASIQEHIEAGITLADAVNFLVERYELVRTDRKGF
TWQQQTPFLTATDILRAKRATGLMNT
MQISTVPATVLVSSRLSPVQVWQQLLTYLLEHHYGLTLNDTPFHDDASIQEHIEAGITLADAVNFLVERYELVRTDRKGF
TWQQQTPFLTATDILRAKRATGLMNT
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|