Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Xre-MNT/HTH_26(antitoxin) |
| Location | 33726..34834 | Replicon | plasmid 6 |
| Accession | NZ_LR134110 | ||
| Organism | Enterococcus faecium isolate E6043 | ||
Toxin (Protein)
| Gene name | MNTss | Uniprot ID | R3JIN1 |
| Locus tag | ELZ65_RS15885 | Protein ID | WP_000233000.1 |
| Coordinates | 33965..34834 (+) | Length | 290 a.a. |
Antitoxin (Protein)
| Gene name | Xress | Uniprot ID | - |
| Locus tag | ELZ65_RS15880 | Protein ID | WP_000205227.1 |
| Coordinates | 33726..33950 (+) | Length | 75 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ELZ65_RS16520 | 29315..29485 | + | 171 | WP_000713595.1 | hypothetical protein | - |
| ELZ65_RS15855 | 29499..30101 | + | 603 | WP_001062586.1 | recombinase family protein | - |
| ELZ65_RS15860 | 30117..30794 | + | 678 | Protein_35 | DNA topoisomerase | - |
| ELZ65_RS15865 | 31306..31602 | + | 297 | WP_002360685.1 | hypothetical protein | - |
| ELZ65_RS15870 | 31603..32019 | + | 417 | WP_000323438.1 | recombinase | - |
| ELZ65_RS15875 | 32021..33583 | + | 1563 | WP_000136908.1 | recombinase family protein | - |
| ELZ65_RS15880 | 33726..33950 | + | 225 | WP_000205227.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| ELZ65_RS15885 | 33965..34834 | + | 870 | WP_000233000.1 | nucleotidyltransferase domain-containing protein | Toxin |
| ELZ65_RS15890 | 34815..35549 | + | 735 | WP_000662263.1 | class I SAM-dependent methyltransferase | - |
| ELZ65_RS15895 | 35582..36445 | + | 864 | WP_002294505.1 | aminoglycoside nucleotidyltransferase ANT(6)-Ia | - |
| ELZ65_RS15900 | 36489..37016 | + | 528 | WP_002294507.1 | adenine phosphoribosyltransferase | - |
| ELZ65_RS15905 | 37244..38563 | + | 1320 | WP_002338419.1 | IS1380-like element ISSsu5 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | cat(pC194) / ant(6)-Ia | - | 1..42954 | 42954 | |
| - | flank | IS/Tn | ant(6)-Ia | - | 35582..38563 | 2981 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 290 a.a. Molecular weight: 32926.57 Da Isoelectric Point: 4.8781
>T286803 WP_000233000.1 NZ_LR134110:33965-34834 [Enterococcus faecium]
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDKNRNNLVVPPGAWGDW
INGGGWLFINGYHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGVEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYKEVNEIVSEINNFLNEESSDERKQI
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDKNRNNLVVPPGAWGDW
INGGGWLFINGYHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGVEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYKEVNEIVSEINNFLNEESSDERKQI
Download Length: 870 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|