Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicB-HicA |
| Location | 1028..1678 | Replicon | plasmid 4 |
| Accession | NZ_LR134108 | ||
| Organism | Enterococcus faecium isolate E6043 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | ELZ65_RS15080 | Protein ID | WP_065305698.1 |
| Coordinates | 1493..1678 (-) | Length | 62 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A829EWE8 |
| Locus tag | ELZ65_RS15075 | Protein ID | WP_002305052.1 |
| Coordinates | 1028..1459 (-) | Length | 144 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ELZ65_RS16490 | 1..843 | + | 843 | WP_172595660.1 | hypothetical protein | - |
| ELZ65_RS15075 | 1028..1459 | - | 432 | WP_002305052.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| ELZ65_RS15080 | 1493..1678 | - | 186 | WP_065305698.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| ELZ65_RS15085 | 1771..1950 | - | 180 | WP_065305697.1 | hypothetical protein | - |
| ELZ65_RS15095 | 2331..3038 | - | 708 | WP_065305695.1 | hypothetical protein | - |
| ELZ65_RS15100 | 3031..3468 | - | 438 | WP_065305694.1 | hypothetical protein | - |
| ELZ65_RS15105 | 3483..3734 | - | 252 | WP_065305693.1 | hypothetical protein | - |
| ELZ65_RS15110 | 3734..3940 | - | 207 | WP_065305692.1 | DNA helicase UvrA | - |
| ELZ65_RS15115 | 4384..4644 | - | 261 | WP_049055261.1 | hypothetical protein | - |
| ELZ65_RS15120 | 4719..4922 | + | 204 | WP_065305691.1 | putative holin-like toxin | - |
| ELZ65_RS15125 | 5082..5339 | - | 258 | WP_065305690.1 | hypothetical protein | - |
| ELZ65_RS15130 | 5361..5834 | - | 474 | WP_065305689.1 | single-stranded DNA-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..54563 | 54563 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6997.21 Da Isoelectric Point: 10.8134
>T286802 WP_065305698.1 NZ_LR134108:c1678-1493 [Enterococcus faecium]
MPLTGKEMLKLLKKNGWVERRQEGSHHHLYKDGVRITVPVHANQDLGRGLERKILKDAGLK
MPLTGKEMLKLLKKNGWVERRQEGSHHHLYKDGVRITVPVHANQDLGRGLERKILKDAGLK
Download Length: 186 bp
Antitoxin
Download Length: 144 a.a. Molecular weight: 15811.92 Da Isoelectric Point: 4.1638
>AT286802 WP_002305052.1 NZ_LR134108:c1459-1028 [Enterococcus faecium]
MLSEPLAKTYPAIFSPEEGGGYFIEFPDVQGAYTGINEDDISYGIAMAQEVLGMVLADYIEHEDLLPEPTPINKISVEDD
SFTTLIRVDVAKYLKDTELVKKTLTIPQWADKLGKRAGINFSVLLTESIADKADNILRSGRNN
MLSEPLAKTYPAIFSPEEGGGYFIEFPDVQGAYTGINEDDISYGIAMAQEVLGMVLADYIEHEDLLPEPTPINKISVEDD
SFTTLIRVDVAKYLKDTELVKKTLTIPQWADKLGKRAGINFSVLLTESIADKADNILRSGRNN
Download Length: 432 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|