Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907-MazE
Location 16925..17532 Replicon plasmid 2
Accession NZ_LR134106
Organism Enterococcus faecium isolate E6043

Toxin (Protein)


Gene name mazF Uniprot ID E3USU0
Locus tag ELZ65_RS13940 Protein ID WP_002321032.1
Coordinates 17182..17532 (+) Length 117 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID A0A829F3C0
Locus tag ELZ65_RS13935 Protein ID WP_002287514.1
Coordinates 16925..17188 (+) Length 88 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ELZ65_RS13890 12009..12908 + 900 WP_010733696.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
ELZ65_RS13895 12911..13408 + 498 WP_002326885.1 single-stranded DNA-binding protein -
ELZ65_RS13900 13774..14034 + 261 WP_002296240.1 hypothetical protein -
ELZ65_RS13905 14479..14685 + 207 WP_002325537.1 hypothetical protein -
ELZ65_RS13910 14733..14936 + 204 WP_110300627.1 hypothetical protein -
ELZ65_RS13915 14952..15389 + 438 WP_126341263.1 hypothetical protein -
ELZ65_RS13920 15382..16089 + 708 WP_002332739.1 hypothetical protein -
ELZ65_RS13930 16469..16699 + 231 WP_126341264.1 hypothetical protein -
ELZ65_RS13935 16925..17188 + 264 WP_002287514.1 hypothetical protein Antitoxin
ELZ65_RS13940 17182..17532 + 351 WP_002321032.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
ELZ65_RS13945 17556..18170 - 615 WP_002318230.1 recombinase family protein -
ELZ65_RS13950 18484..18906 + 423 WP_002288787.1 hypothetical protein -
ELZ65_RS13955 18916..19119 + 204 WP_002299573.1 hypothetical protein -
ELZ65_RS13960 19330..19920 + 591 WP_065305702.1 recombinase family protein -
ELZ65_RS13965 20073..20687 + 615 WP_065305703.1 recombinase family protein -
ELZ65_RS13970 20711..21880 + 1170 Protein_24 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aac(6')-aph(2'') / aph(2'')-Ia - 1..164095 164095


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(6-111)

Antitoxin

Antitoxin PemI-like

(4-87)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 13255.28 Da        Isoelectric Point: 8.0280

>T286800 WP_002321032.1 NZ_LR134106:17182-17532 [Enterococcus faecium]
MVRKPRQGDILLLNTAPRSGHEQTGKRPYIVLSHDIIADYSNVVTVAPISSTTRNYPLYVNINSEYEMKTTGKVLLDQLT
TIDYEARECIFLEKAHDSLVEELLMKVRTVFQKVSK

Download         Length: 351 bp

Antitoxin


Download         Length: 88 a.a.        Molecular weight: 10183.60 Da        Isoelectric Point: 4.6865

>AT286800 WP_002287514.1 NZ_LR134106:16925-17188 [Enterococcus faecium]
MEMLPIKKWGNSNGLRLPKYIMEYLGIHTEDKVKIIQEEVNGQKRLIIEAANIENELTIEQLFENYTDERNHVTIQNLGE
AVGNEKW

Download         Length: 264 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829F5H8

Antitoxin

Source ID Structure
AlphaFold DB A0A829F3C0

References