Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 480760..481331 | Replicon | chromosome |
| Accession | NZ_LR134105 | ||
| Organism | Enterococcus faecium isolate E6043 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | Q3Y2B8 |
| Locus tag | ELZ65_RS02450 | Protein ID | WP_002286801.1 |
| Coordinates | 480990..481331 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A828ZZN9 |
| Locus tag | ELZ65_RS02445 | Protein ID | WP_002323011.1 |
| Coordinates | 480760..480990 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ELZ65_RS02410 | 476241..477569 | + | 1329 | WP_002327434.1 | FAD-containing oxidoreductase | - |
| ELZ65_RS02415 | 477591..478217 | + | 627 | WP_002352507.1 | cysteine hydrolase | - |
| ELZ65_RS02420 | 478400..478981 | + | 582 | WP_002327433.1 | TetR/AcrR family transcriptional regulator | - |
| ELZ65_RS02430 | 479346..479921 | + | 576 | WP_002352505.1 | SOS response-associated peptidase family protein | - |
| ELZ65_RS02435 | 480126..480464 | - | 339 | WP_002306002.1 | hypothetical protein | - |
| ELZ65_RS02445 | 480760..480990 | + | 231 | WP_002323011.1 | hypothetical protein | Antitoxin |
| ELZ65_RS02450 | 480990..481331 | + | 342 | WP_002286801.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| ELZ65_RS02455 | 481666..482123 | + | 458 | Protein_454 | transposase | - |
| ELZ65_RS02460 | 482218..483177 | + | 960 | WP_002301399.1 | IS30 family transposase | - |
| ELZ65_RS02465 | 483183..483893 | + | 711 | Protein_456 | IS3-like element IS1485 family transposase | - |
| ELZ65_RS16310 | 484141..484266 | + | 126 | WP_025478972.1 | LPXTG cell wall anchor domain-containing protein | - |
| ELZ65_RS02475 | 484340..485236 | + | 897 | WP_002352497.1 | class C sortase | - |
| ELZ65_RS02480 | 485417..486091 | + | 675 | WP_002291233.1 | response regulator transcription factor | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 476241..486091 | 9850 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13302.68 Da Isoelectric Point: 9.9044
>T286799 WP_002286801.1 NZ_LR134105:480990-481331 [Enterococcus faecium]
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIITQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIITQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829FD66 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A828ZZN9 |