Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907(toxin)
Location 480760..481331 Replicon chromosome
Accession NZ_LR134105
Organism Enterococcus faecium isolate E6043

Toxin (Protein)


Gene name mazF Uniprot ID Q3Y2B8
Locus tag ELZ65_RS02450 Protein ID WP_002286801.1
Coordinates 480990..481331 (+) Length 114 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID A0A828ZZN9
Locus tag ELZ65_RS02445 Protein ID WP_002323011.1
Coordinates 480760..480990 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ELZ65_RS02410 476241..477569 + 1329 WP_002327434.1 FAD-containing oxidoreductase -
ELZ65_RS02415 477591..478217 + 627 WP_002352507.1 cysteine hydrolase -
ELZ65_RS02420 478400..478981 + 582 WP_002327433.1 TetR/AcrR family transcriptional regulator -
ELZ65_RS02430 479346..479921 + 576 WP_002352505.1 SOS response-associated peptidase family protein -
ELZ65_RS02435 480126..480464 - 339 WP_002306002.1 hypothetical protein -
ELZ65_RS02445 480760..480990 + 231 WP_002323011.1 hypothetical protein Antitoxin
ELZ65_RS02450 480990..481331 + 342 WP_002286801.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
ELZ65_RS02455 481666..482123 + 458 Protein_454 transposase -
ELZ65_RS02460 482218..483177 + 960 WP_002301399.1 IS30 family transposase -
ELZ65_RS02465 483183..483893 + 711 Protein_456 IS3-like element IS1485 family transposase -
ELZ65_RS16310 484141..484266 + 126 WP_025478972.1 LPXTG cell wall anchor domain-containing protein -
ELZ65_RS02475 484340..485236 + 897 WP_002352497.1 class C sortase -
ELZ65_RS02480 485417..486091 + 675 WP_002291233.1 response regulator transcription factor -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 476241..486091 9850


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(10-113)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 13302.68 Da        Isoelectric Point: 9.9044

>T286799 WP_002286801.1 NZ_LR134105:480990-481331 [Enterococcus faecium]
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIITQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF

Download         Length: 342 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8523.39 Da        Isoelectric Point: 3.9078

>AT286799 WP_002323011.1 NZ_LR134105:480760-480990 [Enterococcus faecium]
MLVTKSRLQGSSVVVTLPSDNGKKPSENQEYIVVYSDDGTITLVPKIEDPFSGGEEAEYYEKDEWEDLTPEGREIL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FD66

Antitoxin

Source ID Structure
AlphaFold DB A0A828ZZN9

References