Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
Location | 513121..513692 | Replicon | chromosome |
Accession | NZ_LR134095 | ||
Organism | Enterococcus faecium isolate E1334 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | Q3Y2B8 |
Locus tag | ELZ59_RS02590 | Protein ID | WP_002286801.1 |
Coordinates | 513351..513692 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A828ZZN9 |
Locus tag | ELZ59_RS02585 | Protein ID | WP_002323011.1 |
Coordinates | 513121..513351 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ELZ59_RS02540 | 508241..509572 | + | 1332 | WP_002286818.1 | FAD-containing oxidoreductase | - |
ELZ59_RS02545 | 509594..510220 | + | 627 | WP_002286816.1 | cysteine hydrolase | - |
ELZ59_RS02550 | 510403..510984 | + | 582 | WP_002286813.1 | TetR/AcrR family transcriptional regulator | - |
ELZ59_RS02570 | 511716..512291 | + | 576 | WP_002293673.1 | SOS response-associated peptidase family protein | - |
ELZ59_RS02575 | 512496..512834 | - | 339 | WP_126315669.1 | hypothetical protein | - |
ELZ59_RS02585 | 513121..513351 | + | 231 | WP_002323011.1 | hypothetical protein | Antitoxin |
ELZ59_RS02590 | 513351..513692 | + | 342 | WP_002286801.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
ELZ59_RS02595 | 514542..514727 | + | 186 | WP_002304207.1 | hypothetical protein | - |
ELZ59_RS02600 | 515232..515426 | + | 195 | WP_002295146.1 | hypothetical protein | - |
ELZ59_RS02605 | 515548..515866 | + | 319 | Protein_486 | transposase | - |
ELZ59_RS02615 | 516110..516940 | - | 831 | WP_002286789.1 | manganese catalase family protein | - |
ELZ59_RS02620 | 517148..518481 | + | 1334 | Protein_488 | ABC transporter substrate-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13302.68 Da Isoelectric Point: 9.9044
>T286796 WP_002286801.1 NZ_LR134095:513351-513692 [Enterococcus faecium]
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIITQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIITQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829FD66 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A828ZZN9 |