Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/MazF(toxin)
Location 2159295..2159824 Replicon chromosome
Accession NZ_LR134093
Organism Staphylococcus aureus strain NCTC11965

Toxin (Protein)


Gene name mazF Uniprot ID Q6GF05
Locus tag ELZ56_RS11035 Protein ID WP_000621176.1
Coordinates 2159295..2159657 (-) Length 121 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID T1YCG8
Locus tag ELZ56_RS11040 Protein ID WP_000948331.1
Coordinates 2159654..2159824 (-) Length 57 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ELZ56_RS11010 2156274..2157044 - 771 WP_001041107.1 RNA polymerase sigma factor SigB -
ELZ56_RS11015 2157019..2157498 - 480 WP_001190825.1 anti-sigma B factor RsbW -
ELZ56_RS11020 2157500..2157826 - 327 WP_001052491.1 anti-sigma factor antagonist -
ELZ56_RS11025 2157945..2158946 - 1002 WP_000390829.1 PP2C family protein-serine/threonine phosphatase -
ELZ56_RS11035 2159295..2159657 - 363 WP_000621176.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
ELZ56_RS11040 2159654..2159824 - 171 WP_000948331.1 type II toxin-antitoxin system antitoxin MazE Antitoxin
ELZ56_RS11045 2159909..2161057 - 1149 WP_001281140.1 alanine racemase -
ELZ56_RS11050 2161123..2161482 - 360 WP_000581197.1 holo-ACP synthase -
ELZ56_RS11055 2161486..2161977 - 492 WP_001286801.1 PH domain-containing protein -
ELZ56_RS11060 2161970..2163547 - 1578 WP_001294646.1 PH domain-containing protein -
ELZ56_RS11065 2163540..2164019 - 480 WP_001287082.1 hypothetical protein -
ELZ56_RS11070 2164228..2164788 - 561 WP_001092414.1 K(+)-transporting ATPase subunit C -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(3-110)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 121 a.a.        Molecular weight: 13469.74 Da        Isoelectric Point: 10.1654

>T286789 WP_000621176.1 NZ_LR134093:c2159657-2159295 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVVHQKN

Download         Length: 363 bp

Antitoxin


Download         Length: 57 a.a.        Molecular weight: 6251.78 Da        Isoelectric Point: 3.8305

>AT286789 WP_000948331.1 NZ_LR134093:c2159824-2159654 [Staphylococcus aureus]
MLSFSQNRSHSLEQSLKEGYSQMADLNLSLANEAFPIECEACDCNETYLSSNSTNE

Download         Length: 171 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A168PYX0

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VRZ1

References