Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2159295..2159824 | Replicon | chromosome |
Accession | NZ_LR134093 | ||
Organism | Staphylococcus aureus strain NCTC11965 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | Q6GF05 |
Locus tag | ELZ56_RS11035 | Protein ID | WP_000621176.1 |
Coordinates | 2159295..2159657 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | ELZ56_RS11040 | Protein ID | WP_000948331.1 |
Coordinates | 2159654..2159824 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ELZ56_RS11010 | 2156274..2157044 | - | 771 | WP_001041107.1 | RNA polymerase sigma factor SigB | - |
ELZ56_RS11015 | 2157019..2157498 | - | 480 | WP_001190825.1 | anti-sigma B factor RsbW | - |
ELZ56_RS11020 | 2157500..2157826 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
ELZ56_RS11025 | 2157945..2158946 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
ELZ56_RS11035 | 2159295..2159657 | - | 363 | WP_000621176.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
ELZ56_RS11040 | 2159654..2159824 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
ELZ56_RS11045 | 2159909..2161057 | - | 1149 | WP_001281140.1 | alanine racemase | - |
ELZ56_RS11050 | 2161123..2161482 | - | 360 | WP_000581197.1 | holo-ACP synthase | - |
ELZ56_RS11055 | 2161486..2161977 | - | 492 | WP_001286801.1 | PH domain-containing protein | - |
ELZ56_RS11060 | 2161970..2163547 | - | 1578 | WP_001294646.1 | PH domain-containing protein | - |
ELZ56_RS11065 | 2163540..2164019 | - | 480 | WP_001287082.1 | hypothetical protein | - |
ELZ56_RS11070 | 2164228..2164788 | - | 561 | WP_001092414.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13469.74 Da Isoelectric Point: 10.1654
>T286789 WP_000621176.1 NZ_LR134093:c2159657-2159295 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVVHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVVHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A168PYX0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0VRZ1 |