Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 868808..869285 Replicon chromosome
Accession NZ_LR134093
Organism Staphylococcus aureus strain NCTC11965

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag ELZ56_RS04290 Protein ID WP_000052076.1
Coordinates 868808..868996 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag ELZ56_RS04295 Protein ID WP_001059690.1
Coordinates 869025..869285 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ELZ56_RS04260 864761..865318 + 558 WP_000824491.1 hypothetical protein -
ELZ56_RS04265 865659..866345 + 687 WP_001574556.1 thermonuclease family protein -
ELZ56_RS04270 866702..866902 + 201 WP_001059082.1 cold-shock protein -
ELZ56_RS04275 867399..867617 - 219 WP_000005879.1 hypothetical protein -
ELZ56_RS04280 867679..867963 - 285 WP_001004401.1 hypothetical protein -
ELZ56_RS04285 868051..868620 - 570 WP_001106663.1 hypothetical protein -
ELZ56_RS04290 868808..868996 - 189 WP_000052076.1 hypothetical protein Toxin
ELZ56_RS04295 869025..869285 - 261 WP_001059690.1 hypothetical protein Antitoxin
ELZ56_RS04300 869626..869829 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
ELZ56_RS04305 869826..870062 - 237 WP_000368687.1 hypothetical protein -
ELZ56_RS04310 870287..870868 + 582 WP_001140696.1 phosphoglycerate mutase family protein -
ELZ56_RS04315 870941..871558 - 618 WP_000255545.1 LysE/ArgO family amino acid transporter -
ELZ56_RS04320 871714..872208 - 495 WP_000569884.1 GNAT family N-acetyltransferase -
ELZ56_RS04325 872607..873029 - 423 WP_000974455.1 organic hydroperoxide resistance protein -
ELZ56_RS04330 873177..873893 + 717 WP_000150036.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - vWbp / vWbp 837814..879620 41806


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T286781 WP_000052076.1 NZ_LR134093:c868996-868808 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT286781 WP_001059690.1 NZ_LR134093:c869285-869025 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References