Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4573958..4574756 | Replicon | chromosome |
| Accession | NZ_LR134092 | ||
| Organism | Escherichia coli strain NCTC10444 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A1X1M0U2 |
| Locus tag | EL041_RS22060 | Protein ID | WP_000854919.1 |
| Coordinates | 4573958..4574335 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | EL041_RS22065 | Protein ID | WP_047088564.1 |
| Coordinates | 4574382..4574756 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL041_RS22030 | 4569458..4569637 | + | 180 | WP_001153034.1 | hypothetical protein | - |
| EL041_RS22035 | 4570036..4572072 | - | 2037 | WP_089507572.1 | hypothetical protein | - |
| EL041_RS25610 | 4573025..4573171 | - | 147 | WP_001290177.1 | hypothetical protein | - |
| EL041_RS22050 | 4573256..4573453 | - | 198 | WP_001327226.1 | DUF957 domain-containing protein | - |
| EL041_RS22055 | 4573473..4573961 | - | 489 | WP_000777664.1 | hypothetical protein | - |
| EL041_RS22060 | 4573958..4574335 | - | 378 | WP_000854919.1 | TA system toxin CbtA family protein | Toxin |
| EL041_RS22065 | 4574382..4574756 | - | 375 | WP_047088564.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| EL041_RS22070 | 4574836..4575057 | - | 222 | WP_000692350.1 | DUF987 domain-containing protein | - |
| EL041_RS22075 | 4575144..4575620 | - | 477 | WP_001186188.1 | RadC family protein | - |
| EL041_RS22080 | 4575635..4576114 | - | 480 | WP_000706980.1 | antirestriction protein | - |
| EL041_RS22085 | 4576380..4577198 | - | 819 | WP_001175165.1 | DUF945 domain-containing protein | - |
| EL041_RS22090 | 4577288..4577521 | - | 234 | WP_001278293.1 | DUF905 family protein | - |
| EL041_RS22095 | 4577527..4578204 | - | 678 | WP_001097302.1 | hypothetical protein | - |
| EL041_RS22100 | 4578352..4579032 | - | 681 | WP_001282922.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4564528..4594868 | 30340 | |
| - | inside | Genomic island | - | - | 4564528..4582038 | 17510 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14037.97 Da Isoelectric Point: 7.9086
>T286777 WP_000854919.1 NZ_LR134092:c4574335-4573958 [Escherichia coli]
MKTLSDTHVREVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGTSSQLINSIDILRARRATGLMTRSNYRTVNNITLGKHPEAKQ
MKTLSDTHVREVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGTSSQLINSIDILRARRATGLMTRSNYRTVNNITLGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13600.33 Da Isoelectric Point: 5.5051
>AT286777 WP_047088564.1 NZ_LR134092:c4574756-4574382 [Escherichia coli]
VSDTLSGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPAITS
VSDTLSGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPAITS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|