Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4375339..4375889 Replicon chromosome
Accession NZ_LR134092
Organism Escherichia coli strain NCTC10444

Toxin (Protein)


Gene name ccdB Uniprot ID Q32K46
Locus tag EL041_RS21210 Protein ID WP_001160974.1
Coordinates 4375339..4375653 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag EL041_RS21215 Protein ID WP_000125566.1
Coordinates 4375656..4375889 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL041_RS21185 4371014..4372300 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
EL041_RS21190 4372300..4373289 + 990 WP_089610127.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
EL041_RS21195 4373286..4374107 + 822 WP_001065381.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
EL041_RS21200 4374110..4374487 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
EL041_RS21205 4374494..4375342 + 849 WP_000257188.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
EL041_RS21210 4375339..4375653 - 315 WP_001160974.1 CcdB family protein Toxin
EL041_RS21215 4375656..4375889 - 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
EL041_RS21220 4375975..4376454 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
EL041_RS21230 4376647..4378509 - 1863 WP_126298055.1 glutathione-regulated potassium-efflux system protein KefC -
EL041_RS21235 4378502..4379032 - 531 WP_072686445.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
EL041_RS21240 4379140..4380471 - 1332 WP_089610134.1 MFS transporter -
EL041_RS21245 4380530..4380817 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11737.84 Da        Isoelectric Point: 9.8517

>T286775 WP_001160974.1 NZ_LR134092:c4375653-4375339 [Escherichia coli]
MQFTVYRSRSRNAAFPFVIDVTSDIIGVINRRIVIPLTPIERFIRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT286775 WP_000125566.1 NZ_LR134092:c4375889-4375656 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LRR3

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References